CD300a/LMIR1 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
CD300a/LMIR1 protein inhibits cytolytic activity in NK cells and mast cell degranulation. It negatively regulates TLR signaling via MYD88 and PTPN6 activation, but not TRIF. CD300a/LMIR1 interacts with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D upon tyrosine phosphorylation. CD300a/LMIR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD300a/LMIR1 protein inhibits cytolytic activity in NK cells and mast cell degranulation. It negatively regulates TLR signaling via MYD88 and PTPN6 activation, but not TRIF. CD300a/LMIR1 interacts with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D upon tyrosine phosphorylation. CD300a/LMIR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD300a/LMIR1 protein serves as an inhibitory receptor that potentially contributes to the down-regulation of cytolytic activity in natural killer (NK) cells and the attenuation of mast cell degranulation. Additionally, it plays a negative regulatory role in Toll-like receptor (TLR) signaling, specifically mediated by MYD88 but not TRIF, by activating PTPN6. Upon tyrosine phosphorylation, CD300a/LMIR1 interacts with PTN6/SHP-1 and PTPN11/SHP-2, along with INPP5D.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q6SJQ0-1 (L28-P185)
-
Molecular Construction
-
N-term
-
CD300A (L28-P185)
Accession # Q6SJQ0-1 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD300A; CMRF35-Like Molecule 8; CD300a Molecule; NK Inhibitory Receptor; CMRF-35-H9; CMRF35-H9; CMRF35H; IRC1/IRC2; IGSF12; CMRF35-H; CD300a Antigen; CLM-8; Irp60; CMRF35H Leukocyte Immunoglobulin-Like Receptor; IRC1; Leukocyte Membrane Antigen; IRC2; CMR
-
AA Sequence
LHGPSTMSGSVGESLSVSCRYEEKFKTKDKYWCRVSLKILCKDIVKTSSSEEARSGRVTIRDHPDNLTFTVTYESLTLEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPVSSPGPTLETPVVSTSLPTKGPALGSNTEGHREHDYSQGLRLP
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
