CD300a/LMIR1 Protein, Mouse (HEK293, His)

CD300a/LMIR1 protein inhibits cytolytic activity in NK cells and mast cell degranulation. It negatively regulates TLR signaling via MYD88 and PTPN6 activation, but not TRIF. CD300a/LMIR1 interacts with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D upon tyrosine phosphorylation. CD300a/LMIR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-His labeled tag.

CD300a/LMIR1 protein serves as an inhibitory receptor that potentially contributes to the down-regulation of cytolytic activity in natural killer (NK) cells and the attenuation of mast cell degranulation. Additionally, it plays a negative regulatory role in Toll-like receptor (TLR) signaling, specifically mediated by MYD88 but not TRIF, by activating PTPN6. Upon tyrosine phosphorylation, CD300a/LMIR1 interacts with PTN6/SHP-1 and PTPN11/SHP-2, along with INPP5D.

Mouse

HEK293

C-8*His

Q6SJQ0-1 (L28-P185)

217303  [NCBI]

Extracellular Domain

LHGPSTMSGSVGESLSVSCRYEEKFKTKDKYWCRVSLKILCKDIVKTSSSEEARSGRVTIRDHPDNLTFTVTYESLTLEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPVSSPGPTLETPVVSTSLPTKGPALGSNTEGHREHDYSQGLRLP

35-50 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.