CD300a/LMIR1 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD300a/LMIR1 protein inhibits cytolytic activity in NK cells and mast cell degranulation. It negatively regulates TLR signaling via MYD88 and PTPN6 activation, but not TRIF. CD300a/LMIR1 interacts with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D upon tyrosine phosphorylation. CD300a/LMIR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD300a/LMIR1 protein inhibits cytolytic activity in NK cells and mast cell degranulation. It negatively regulates TLR signaling via MYD88 and PTPN6 activation, but not TRIF. CD300a/LMIR1 interacts with PTN6/SHP-1, PTPN11/SHP-2, and INPP5D upon tyrosine phosphorylation. CD300a/LMIR1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD300a/LMIR1 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD300a/LMIR1 protein serves as an inhibitory receptor that potentially contributes to the down-regulation of cytolytic activity in natural killer (NK) cells and the attenuation of mast cell degranulation. Additionally, it plays a negative regulatory role in Toll-like receptor (TLR) signaling, specifically mediated by MYD88 but not TRIF, by activating PTPN6. Upon tyrosine phosphorylation, CD300a/LMIR1 interacts with PTN6/SHP-1 and PTPN11/SHP-2, along with INPP5D.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD300A (L28-P185)
      Accession # Q6SJQ0-1
    • 8*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD300A; CMRF35-Like Molecule 8; CD300a Molecule; NK Inhibitory Receptor; CMRF-35-H9; CMRF35-H9; CMRF35H; IRC1/IRC2; IGSF12; CMRF35-H; CD300a Antigen; CLM-8; Irp60; CMRF35H Leukocyte Immunoglobulin-Like Receptor; IRC1; Leukocyte Membrane Antigen; IRC2; CMR

  • AA Sequence

    LHGPSTMSGSVGESLSVSCRYEEKFKTKDKYWCRVSLKILCKDIVKTSSSEEARSGRVTIRDHPDNLTFTVTYESLTLEDADTYMCAVDISLFDGSLGFDKYFKIELSVVPSEDPVSSPGPTLETPVVSTSLPTKGPALGSNTEGHREHDYSQGLRLP

  • Predicted Molecular Mass

    20 kDa

  • Molecular Weight

    Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00