CD302/CLEC13A Protein, Rat (HEK293, Fc)
The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD302/CLEC13A protein emerged as a potential multifunctional C-type lectin receptor, indicating its widespread involvement in cellular processes. This protein has a potential role in endocytosis and phagocytosis and is involved in cellular clearance. CD302/CLEC13A Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD302/CLEC13A protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD302/CLEC13A Protein emerges as a potential multifunctional C-type lectin receptor, suggesting its versatile involvement in various cellular processes. The protein exhibits potential roles in endocytosis and phagocytosis, indicating its participation in cellular clearance mechanisms. Moreover, CD302/CLEC13A is implicated in cell adhesion and migration, hinting at its possible contributions to cellular interactions and tissue dynamics. The multifaceted nature of CD302/CLEC13A suggests its potential significance in orchestrating diverse cellular functions, prompting further investigation to elucidate the specific mechanisms and regulatory pathways through which it operates in different cellular contexts.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
Q5FVR3 (D21-H165)
-
Molecular Construction
-
N-term
-
CD302 (D21-H165)
Accession # Q5FVR3 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD302; Type I Transmembrane C-Type Lectin Receptor DCL-1; CD302 Molecule; C-Type Lectin Domain Family 13, Member A; CLEC13A; DEC205-Associated C-Type Lectin 1; CD302 Antigen; DCL1; KIAA0022; C-Type Lectin Domain Family 13 Member A; BIMLEC; C-Type Lectin B
-
AA Sequence
DCPSSIWVQFQGSCYTFLQVTINVENIEDVRKQCTDHGADLVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTDDASFKWFDQSNMTFDKWADEDGEDLVDTCGFLYAKTGEWRKGNCEMSSVTGTLCKTAIPYDKKYLSDNH
-
Predicted Molecular Mass
43.7 kDa
-
Molecular Weight
Approximately 47 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
