CD36 Protein, Rhesus Macaque (HEK293, Fc)
CD36 protein is a member of the CD36 family and plays a key role in a variety of cellular processes, particularly involved in lipid metabolism, inflammation, and immune responses. It acts as a multifunctional receptor that binds to a variety of ligands, including lipids, cholesterol, fatty acids, and apoptotic cells. CD36 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CD36 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD36 protein is a member of the CD36 family and plays a key role in a variety of cellular processes, particularly involved in lipid metabolism, inflammation, and immune responses. It acts as a multifunctional receptor that binds to a variety of ligands, including lipids, cholesterol, fatty acids, and apoptotic cells. CD36 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CD36 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD36 Protein, a member of the CD36 family, plays a pivotal role in a wide range of cellular processes, with notable involvement in lipid metabolism, inflammation, and immune responses. It acts as a multifunctional receptor that binds to a diverse array of ligands, including lipids, cholesterol, fatty acids, and apoptotic cells. Through these interactions, CD36 Protein regulates lipid uptake, storage, and metabolism, contributing to the balance of lipid homeostasis in cells. Additionally, CD36 Protein is implicated in the modulation of inflammatory responses, acting as a sensor for pathogen-associated molecular patterns (PAMPs) and damage-associated molecular patterns (DAMPs). Moreover, CD36 Protein participates in immune responses by facilitating the recognition and clearance of pathogens and cellular debris. Its multifaceted roles make CD36 Protein a crucial player in various physiological and pathological processes.
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag C-hFc
-
Accession
Q6J512 (G30-N439)
-
Molecular Construction
-
N-term
-
CD36 (G30-N439)
Accession # Q6J512 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD36; Leukocyte Differentiation Antigen CD36; CD36 Molecule (CD36 Blood Group); Thrombospondin Receptor; Platelet Glycoprotein 4; CD36 Antigen; GPIIIB; PAS-4; GPIV; CD36 Molecule (CD36 Blood Group) Transcript; GP3B; Scavenger Receptor Class B, Member 3; F
-
AA Sequence
GDMLIQKTIKKEVVLEEGTIAFKNWVKTGTEIYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENITQDPKDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYPNPFVQVVLNSLINKSKSSMFQVRTLRELLWGYTDPFLSLVPYPVSTRVGMFYPYNNTADGVYKVFNGKDSISKVAIIDTYKGKRNLSYWESYCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVQNPDNHCFCTEKIISKNCTSYGVLDISKCKEGKPVYISLPHFLYASPDVSETIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSNKIQVLKRLKRNYIVPILWLNETGTIGDEKAKMFRSQVTGKIN
-
Predicted Molecular Mass
73.6 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
