CD36 Protein, Rhesus Macaque (HEK293, Fc)

CD36 protein is a member of the CD36 family and plays a key role in a variety of cellular processes, particularly involved in lipid metabolism, inflammation, and immune responses. It acts as a multifunctional receptor that binds to a variety of ligands, including lipids, cholesterol, fatty acids, and apoptotic cells. CD36 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CD36 protein, expressed by HEK293 , with C-hFc labeled tag.

CD36 Protein, a member of the CD36 family, plays a pivotal role in a wide range of cellular processes, with notable involvement in lipid metabolism, inflammation, and immune responses. It acts as a multifunctional receptor that binds to a diverse array of ligands, including lipids, cholesterol, fatty acids, and apoptotic cells. Through these interactions, CD36 Protein regulates lipid uptake, storage, and metabolism, contributing to the balance of lipid homeostasis in cells. Additionally, CD36 Protein is implicated in the modulation of inflammatory responses, acting as a sensor for pathogen-associated molecular patterns (PAMPs) and damage-associated molecular patterns (DAMPs). Moreover, CD36 Protein participates in immune responses by facilitating the recognition and clearance of pathogens and cellular debris. Its multifaceted roles make CD36 Protein a crucial player in various physiological and pathological processes.

Rhesus Macaque

HEK293

C-hFc

Q6J512 (G30-N439)

574296  [NCBI]

Extracellular Domain

GDMLIQKTIKKEVVLEEGTIAFKNWVKTGTEIYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENITQDPKDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYPNPFVQVVLNSLINKSKSSMFQVRTLRELLWGYTDPFLSLVPYPVSTRVGMFYPYNNTADGVYKVFNGKDSISKVAIIDTYKGKRNLSYWESYCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVQNPDNHCFCTEKIISKNCTSYGVLDISKCKEGKPVYISLPHFLYASPDVSETIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSNKIQVLKRLKRNYIVPILWLNETGTIGDEKAKMFRSQVTGKIN

≥ 80%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.