CD367/CLEC4A Protein, Mouse (HEK293, Fc)

CD367/CLEC4A protein may regulate immune responses and affect dendritic cell (DC) differentiation.As a C-type lectin receptor, it binds carbohydrates and interacts weakly with N-acetylglucosamine.CD367/CLEC4A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD367/CLEC4A protein, expressed by HEK293 , with C-hFc labeled tag.

The CD367/CLEC4A protein potentially plays a role in regulating immune reactivity and may have implications in modulating the differentiation and maturation of dendritic cells (DC). It is a C-type lectin receptor that can bind to carbohydrates such as mannose and fucose, as well as weakly interact with N-acetylglucosamine (GlcNAc) in a Ca(2+)-dependent manner. CD367/CLEC4A is involved in inhibiting B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation. Upon antigen stimulation, it undergoes clathrin-dependent endocytosis, delivering its antigenic cargo into the antigen presentation pathway and promoting cross-priming of CD8(+) T cells. This cross-presentation and cross-priming process can be enhanced by TLR7 and TLR8 agonists, resulting in increased expansion of CD8(+) T cells and high production of IFNG and TNF, while reducing levels of IL4, IL5, and IL13. In plasmacytoid dendritic cells, CD367/CLEC4A inhibits TLR9-mediated production of IFNA and TNF. Furthermore, its ITIM motif (immunoreceptor tyrosine-based inhibitory motifs) may contribute to the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.

Mouse

HEK293

C-hFc

Q9QZ15 (Q70-L238)

26888  [NCBI]

Extracellular Domain

QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL

Approximately 60-65 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.