CD40 Protein, Mouse (Biotinylated , HEK293, His-Avi)
CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through the TRAF6 and MAP3K8 pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion.CD40 exists in monomeric and homodimeric forms, interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6) and crucially mediates cellular responses to external signals.CD40 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived CD40 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD40 protein is a TNFSF5/CD40LG receptor that transduces signals through the TRAF6 and MAP3K8 pathways, activates ERK in macrophages and B cells, and induces immunoglobulin secretion.CD40 exists in monomeric and homodimeric forms, interacts with TRAF proteins (TRAF1, TRAF2, TRAF3, TRAF5 and TRAF6) and crucially mediates cellular responses to external signals.CD40 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived CD40 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
CD40 Protein serves as the receptor for TNFSF5/CD40LG, transducing signals through TRAF6 and MAP3K8 pathways to activate ERK in macrophages and B cells, resulting in the induction of immunoglobulin secretion. Existing in both monomeric and homodimeric forms, CD40 Protein interacts with TRAF1, TRAF2, TRAF3, TRAF5, and TRAF6, playing a crucial role in mediating cellular responses to external signals. The interaction with TRAF6 and MAP3K8 is particularly essential for the activation of ERK and subsequent cellular processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P27512-1/NP_035741.2 (L20-R193)
-
Molecular Construction
-
N-term
-
CD40 (L20-R193)
Accession # P27512-1/NP_035741.2 -
His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily
-
AA Sequence
LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMR
-
Predicted Molecular Mass
22.5 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
