CD40 Protein, Rhesus Macaque (HEK293, Fc)
TNFR5/CD40 protein does not possess the necessary conserved residue(s) for propagating feature annotation. CD40 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TNFR5/CD40 protein does not possess the necessary conserved residue(s) for propagating feature annotation. CD40 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
TNFR5/CD40 Protein lacks conserved residue(s) required for the propagation of feature annotation.
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag C-hFc
-
Accession
F6SNI1/NP_001252791.1 (E21-R193)
-
Molecular Construction
-
N-term
-
CD40 (E21-R193)
Accession # F6SNI1/NP_001252791.1 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily
-
AA Sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCSESEFLDTWNRETRCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGLHCMSESCESCVPHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETKDLVVQQAGTNKTDVVCGPQDRQR
-
Predicted Molecular Mass
46.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
