CD40 Protein, Rhesus Macaque (HEK293, Fc)

TNFR5/CD40 protein does not possess the necessary conserved residue(s) for propagating feature annotation. CD40 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TNFR5/CD40 protein does not possess the necessary conserved residue(s) for propagating feature annotation. CD40 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CD40 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

TNFR5/CD40 Protein lacks conserved residue(s) required for the propagation of feature annotation.

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD40 (E21-R193)
      Accession # F6SNI1/NP_001252791.1
    • hFc
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD40; B-Cell Surface Antigen CD40; Prev. TNFRSF5; B Cell Surface Antigen CD40; Bp50; B Cell-Associated Molecule; Tumor Necrosis Factor Receptor Superfamily Member 5; CD40 Antigen; CD40L Receptor; CDW40; P50; CDw40; CD40 Molecule, TNF Receptor Superfamily

  • AA Sequence

    EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCSESEFLDTWNRETRCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGLHCMSESCESCVPHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETKDLVVQQAGTNKTDVVCGPQDRQR

  • Predicted Molecular Mass

    46.2 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00