CD42c/GP1BB Protein, Rat (HEK293, Fc)
Based on 1 Customer Validation
The CD42c protein is a platelet surface membrane protein that actively assembles plugs by binding to von Willebrand factor (vWF) in the subendothelium. The GP-Ib heterodimer is formed from the disulfide-linked GP-Ib β subunit and one GP-Ib α subunit, which constitute this protein complex. CD42c/GP1BB Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD42c protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD42c protein is a platelet surface membrane protein that actively assembles plugs by binding to von Willebrand factor (vWF) in the subendothelium. The GP-Ib heterodimer is formed from the disulfide-linked GP-Ib β subunit and one GP-Ib α subunit, which constitute this protein complex. CD42c/GP1BB Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD42c protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD42c, a surface membrane protein on platelets, actively contributes to the assembly of platelet plugs by engaging with von Willebrand factor (vWF), which is pre-bound to the subendothelium. This protein complex comprises two GP-Ib beta subunits disulfide-linked to one GP-Ib alpha subunit, forming the GP-Ib heterodimer. Additionally, GP-IX is intricately associated with the GP-Ib heterodimer through a non-covalent linkage, enhancing the structural integrity and functionality of this platelet surface receptor. In molecular interactions, CD42c shows similarity to its association with tumor necrosis factor receptor-associated factor 4 (TRAF4), contributing to the regulatory network governing platelet function.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9JJM7 (P27-C147)
-
Molecular Construction
-
N-term
-
CD42c (P27-C147)
Accession # Q9JJM7 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
GP1BB; Truncated Platelet Membrane Glycoprotein Ib Beta; Glycoprotein Ib Platelet Subunit Beta; Platelet Membrane Glycoprotein Ib Beta; Platelet Glycoprotein Ib Beta Chain; Glycoprotein Ib Platelet Beta Subunit; Antigen CD42b-Beta; CD42c Antigen; GPIbbeta
-
AA Sequence
PAPCRCSETRVDCGRRGLTWASLPAAFPPDTTELVLTDNNLTALPPGLLDTLPALRRVHLGANPWRCDCRLLPLRAWLAGRPEREFYRDLRCVAPLALRGRLLPYVAEDELRAACAPGLLC
-
Molecular Weight
Approximately 63 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
