CD46 Protein, Canine (HEK293, His)
CD46 protein does not possess the conserved residue(s) necessary for propagating feature annotation. CD46 Protein, Canine (HEK293, His) is the recombinant canine-derived CD46 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD46 protein does not possess the conserved residue(s) necessary for propagating feature annotation. CD46 Protein, Canine (HEK293, His) is the recombinant canine-derived CD46 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD46 Protein lacks conserved residue(s) required for the propagation of feature annotation.
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A8C0YZN5 (C45-G344)
-
Molecular Construction
-
N-term
-
CD46 (C45-G344)
Accession # A0A8C0YZN5 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD46; CD46 Molecule, Complement Regulatory Protein; Prev. MIC10; Trophoblast Leukocyte Common Antigen; Prev. MCP; MGC26544; TLX; Complement System Membrane Cofactor Protein CD46; Membrane Cofactor Protein; Complement Membrane Cofactor Protein; TRA2.10; Tr
-
AA Sequence
CDRPAYISMKPNVSKMNFDPGDTIFFTCNLGYRPIRPLLPMSSVCQPDNTWTPLKEGCTKKSCLHPGEPSNGQVVLVDESLLFGSKIQYSCNEGFRLVGQKNLYCEISSTDSNRVVWSDDPPLCTKILCQPPGKIENGKYSDSHKDEFEYNEVVTYSCEKSQGTDEYSLIGDNKLICSGDGEWSSNPPECKVVRCPLPDPENGKLVLGFSRKYYYKARIEFECLSGFYHKGTNFAICGSNSTWEPEMPMCLKVPIPPTTSPPILSHTVSSPPSTNSPIPSVSGSPKPSDETPPSDTSGKG
-
Predicted Molecular Mass
34.1 kDa
-
Molecular Weight
Approximately 50-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
