CD5 Protein, Human (214a.a, HEK293, Fc)
The CD5 protein is a potential receptor that regulates T cell proliferation. Its interactions with CD72/LYB-2 and PTPN6/SHP-1 indicate multifaceted roles in cellular processes, serving as key mediators of T cell responses. CD5 Protein, Human (214a.a, HEK293, Fc) is the recombinant human-derived CD5 protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CD5 protein is a potential receptor that regulates T cell proliferation. Its interactions with CD72/LYB-2 and PTPN6/SHP-1 indicate multifaceted roles in cellular processes, serving as key mediators of T cell responses. CD5 Protein, Human (214a.a, HEK293, Fc) is the recombinant human-derived CD5 protein, expressed by HEK293, with C-hFc labeled tag.
Background
The CD5 Protein presents itself as a potential receptor implicated in the regulation of T-cell proliferation. Its interaction with CD72/LYB-2 and PTPN6/SHP-1 suggests a multifaceted role in modulating cellular processes. Acting as a receptor, this protein may play a pivotal part in orchestrating T-cell responses, mediating crucial interactions with other cellular components. The engagement with CD72/LYB-2 and PTPN6/SHP-1 underscores its involvement in intricate signaling pathways, hinting at its significance in the regulatory networks that govern T-cell behavior. Further exploration of the CD5 Protein's functions could provide valuable insights into the molecular mechanisms underlying T-cell proliferation and immune modulation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P06127 (L159-P372)
-
Gene ID921
-
Molecular Construction
-
N-term
-
CD5 (L159-P372)
Accession # P06127 -
hFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CD5; Lymphocyte Antigen T1/Leu-1; Prev. LEU1; Epididymis Secretory Sperm Binding Protein; T-Cell Surface Glycoprotein CD5; CD5 Antigen; T1; CD5 Molecule; CD5 Antigen (P56-62)
-
AA Sequence
LQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNP
-
Predicted Molecular Mass
50.1 kDa
-
Molecular Weight
Approximately 55-57 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)