CD53 Protein, Mouse (HEK293, His)
CD53 Protein plays a crucial role in efficient myofiber formation during muscle regeneration, specifically facilitating cell fusion. Additionally, CD53 is implicated in growth regulation in hematopoietic cells. Its interaction with SCIMP underscores its involvement in various cellular processes. CD53 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD53 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CD53 Protein plays a crucial role in efficient myofiber formation during muscle regeneration, specifically facilitating cell fusion. Additionally, CD53 is implicated in growth regulation in hematopoietic cells. Its interaction with SCIMP underscores its involvement in various cellular processes. CD53 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD53 protein, expressed by HEK293 , with N-His labeled tag.
CD53 Protein is a crucial component necessary for the efficient formation of myofibers during the regeneration process of muscle, specifically aiding in cell fusion. Additionally, CD53 has been implicated in growth regulation in hematopoietic cells. Furthermore, it interacts with SCIMP, further highlighting its involvement in cellular processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-His
-
Accession
Q61451 (E107-N181)
-
Molecular Construction
-
N-term
-
His
-
CD53 (E107-N181)
Accession # Q61451 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CD53; Tspan-25; Prev. MOX44; Antigen MOX44 Identified By Monoclonal Antibody MRC-OX44; TSPAN25; Transmembrane Glycoprotein; CD53 Antigen; CD53 Tetraspan Antigen; Leukocyte Surface Antigen CD53; Cell Surface Antigen; Cell Surface Glycoprotein CD53; CD53 Gl
-
AA Sequence
EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN
-
Predicted Molecular Mass
10.6 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
