CD59 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (HEK293, His) is the recombinant human-derived CD59 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (HEK293, His) is the recombinant human-derived CD59 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) action. It functions by binding to the assembling MAC's C8 and/or C9 complements, thereby impeding the incorporation of multiple copies of C9 necessary for the formation of the osmolytic pore. Notably, this inhibitor exhibits species-specificity. Additionally, CD59 is involved in T-cell activation complexed with a protein tyrosine kinase for signal transduction. It is worth noting that while the soluble form of CD59 from urine retains its specific complement binding activity, it demonstrates a significantly reduced ability to inhibit MAC assembly on cell membranes.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD59 (L26-N102)
      Accession # P13987-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    CD59; CD59 Molecule, Complement Regulatory Protein; Prev. HRF20; CD59 Blood Group Antigen; Prev. MACIF; MAC-Inhibitory Protein; Prev. MIC11; MEM43 Antigen; Prev. MSK21; 1F5 Antigen; Prev. MIN1; HRF-20; Prev. MIN2; MAC-IP; Prev. MIN3; Surface Anitgen Recog

  • AA Sequence

    LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

  • Predicted Molecular Mass

    9.8 kDa

  • Molecular Weight

    Approximately 15-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00