1. Recombinant Proteins
  2. CD Antigens
  3. Platelet CD Proteins Endothelial cell CD Proteins
  4. LAMP3/CD63
  5. CD63 Protein, Pig (HEK293, Fc)

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Pig (HEK293, Fc) is the recombinant pig-derived CD63 protein, expressed by HEK293 , with N-hFc labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
Kostenlose Probe   Apply now
Kostenlose Probe   Apply now
5 μg Auf Lager
10 μg Auf Lager
50 μg Auf Lager
100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Pig (HEK293, Fc) is the recombinant pig-derived CD63 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

CD63 protein serves as a cell surface receptor for TIMP1, playing a crucial role in the activation of cellular signaling cascades. It contributes to the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2, and MAP kinases. Its involvement promotes cell survival, actin cytoskeleton reorganization, cell adhesion, spreading, and migration by activating AKT and FAK/PTK2. CD63 is also implicated in VEGFA signaling through its regulation of KDR/VEGFR2 internalization. Additionally, it plays a role in intracellular vesicular transport processes and is essential for the normal trafficking of the PMEL luminal domain, crucial for melanocyte development and maturation. CD63 is further involved in leukocyte adhesion to endothelial cells by regulating SELP trafficking. While it may participate in mast cell degranulation in response to Ms4a2/FceRI stimulation, its role in degranulation in response to other stimuli remains limited. CD63 interacts with TIMP1 and ITGB1, recruiting TIMP1 to ITGB1, forms a complex with CD9 and ITGB3, and interacts with PMEL, KDR/VEGFR2, and SYT7.

Biologische Aktivität

Measured by its binding ability in a functional ELISA. Immobilized Human BST2 at 2.5 μg/mL (100μL/well) can bind Pig CD63. The ED50 for this effect is 2.754 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human BST2 at 2.5 μg/mL (100μL/well) can bind Pig CD63. The ED50 for this effect is 2.754 μg/mL.
Species

Pig

Source

HEK293

Tag

N-hFc

Accession

XP_003355519.1 (R108-F204)

Gene ID
Molecular Construction
N-term
hFc
CD63 (R108-F204)
Accession # XP_003355519.1
C-term
Protein Length

Partial

Synonyms
CD63 antigen; LAMP-3; Tspan-30; CD63; MLA1; TSPAN30
AA Sequence

RDKVKAEFNKDFQQQMQNYPKNNHTALILDRMQEDFKCCGAANYTDWEKILLSPKRVPDSCCVNVTQHCGVNFNVKEIHNEGCVEKIGSWLRSNVLV

Molekulargewicht

Approximately 50 kDa

Reinheit
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Dokumentation

CD63 Protein, Pig (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

CD63 Protein, Pig (HEK293, Fc)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
CD63 Protein, Pig (HEK293, Fc)
Art. -Nr.:
HY-P76810
Menge:
MCE Japan Authorized Agent: