CD63 Protein, Pig (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Pig (HEK293, Fc) is the recombinant pig-derived CD63 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Pig
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CD63 protein serves as a cell surface receptor for TIMP1 and is critical for activating signaling cascades. It contributes to ITGB1 and integrin signaling, activating AKT, FAK/PTK2 and MAP kinases to promote cell survival, cytoskeletal reorganization, adhesion, spreading and migration. CD63 Protein, Pig (HEK293, Fc) is the recombinant pig-derived CD63 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

CD63 protein serves as a cell surface receptor for TIMP1, playing a crucial role in the activation of cellular signaling cascades. It contributes to the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2, and MAP kinases. Its involvement promotes cell survival, actin cytoskeleton reorganization, cell adhesion, spreading, and migration by activating AKT and FAK/PTK2. CD63 is also implicated in VEGFA signaling through its regulation of KDR/VEGFR2 internalization. Additionally, it plays a role in intracellular vesicular transport processes and is essential for the normal trafficking of the PMEL luminal domain, crucial for melanocyte development and maturation. CD63 is further involved in leukocyte adhesion to endothelial cells by regulating SELP trafficking. While it may participate in mast cell degranulation in response to Ms4a2/FceRI stimulation, its role in degranulation in response to other stimuli remains limited. CD63 interacts with TIMP1 and ITGB1, recruiting TIMP1 to ITGB1, forms a complex with CD9 and ITGB3, and interacts with PMEL, KDR/VEGFR2, and SYT7.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human BST2 at 2.5 μg/mL (100μL/well) can bind Pig CD63. The ED50 for this effect is 2.754 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human BST2 at 2.5 μg/mL (100μL/well) can bind Pig CD63. The ED50 for this effect is 2.754 μg/mL.

Technical Parameters

  • Species Pig
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • CD63 (R108-V204)
      Accession # XP_003355519.1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD63; Tetraspanin-30; Prev. MLA1; AD1 Antigen; TSPAN30; Tspan-30; CD63 Antigen; OMA81H; Pltgp40; Limp1; HOP-26; Lysosomal-Associated Membrane Protein 3; ME491; Lysosome Integral Membrane Protein 1; AD1; Melanoma-Associated Antigen MLA1; Ocular Melanoma-As

  • AA Sequence

    RDKVKAEFNKDFQQQMQNYPKNNHTALILDRMQEDFKCCGAANYTDWEKILLSPKRVPDSCCVNVTQHCGVNFNVKEIHNEGCVEKIGSWLRSNVLV

  • Molecular Weight

    Approximately 48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00