1. Recombinant Proteins
  2. CD Antigens Fc Receptors
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Fc-gamma Receptor
  4. Fc-gamma Receptor I/CD64
  5. CD64 Protein, Canine (HEK293, His)

CD64 Protein, Canine (HEK293, His) is the recombinant canine-derived CD64 protein, expressed by HEK293, with C-His tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

CD64 Protein, Canine (HEK293, His) is the recombinant canine-derived CD64 protein, expressed by HEK293, with C-His tag.

Background

CD64 Protein, characterized by its leukotriene receptor binding activity, plays a crucial role in various biological processes, including the positive regulation of phagocytosis and the sensory perception of pain, as well as the response to epinephrine. Situated in membrane rafts, CD64, encoded by the FCGR1A gene, exhibits a biased expression pattern with notable levels in the Spleen (RPKM 177.3), Lung (RPKM 93.7), and nine other tissues. This underlines its significance in immune responses and sensory functions across diverse physiological contexts.

Species

Canine

Source

HEK293

Tag

C-His

Accession

NP_001002976.1 (V11-P288)

Gene ID

403462

Protein Length

Partial

Synonyms
High affinity immunoglobulin gamma Fc receptor I; Fcgr1; FcRI; CD64; Fc receptor; IgG; high affinity I
AA Sequence

VPAGAQTDPVKAVITLQPPWVSVFQEESVTLWCEGPHLPGDSSTQWFLNGTATQTLTPRYRIAAASVNDNGEYRCQTGLSVLSDPIQLGIHRDWLILQVSGRVFTEGEPLTLRCHGWNNKLVYNVLFYQNGTVLKFSPQNSEFTILKTTLHHNGIYHCSAMGKHRYESAGVSITIKELFPAPVLKASLSSPILEGHVVNLSCETKLLLQRPGLQLYFSFYMGSKTLLSRNTSSEYQILTAKKEDSGLYWCEATTEDGNVVKRSPELELQVVGPQTLTP

Predicted Molecular Mass
31.9 kDa
분자량

Approximately 43.6 kDa & 40.2 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD64 Protein, Canine (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD64 Protein, Canine (HEK293, His)
Cat. No.:
HY-P703825
수량:
MCE Japan Authorized Agent: