CD64 Protein, Canine (HEK293, His)
CD64 Protein, Canine (HEK293, His) is the recombinant canine-derived CD64 protein, expressed by HEK293, with C-His tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD64 Protein, Canine (HEK293, His) is the recombinant canine-derived CD64 protein, expressed by HEK293, with C-His tag.
Background
CD64 Protein, characterized by its leukotriene receptor binding activity, plays a crucial role in various biological processes, including the positive regulation of phagocytosis and the sensory perception of pain, as well as the response to epinephrine. Situated in membrane rafts, CD64, encoded by the FCGR1A gene, exhibits a biased expression pattern with notable levels in the Spleen (RPKM 177.3), Lung (RPKM 93.7), and nine other tissues. This underlines its significance in immune responses and sensory functions across diverse physiological contexts.
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-His
-
Accession
NP_001002976.1 (V11-P288)
-
Gene ID403462
-
Protein Length
Partial
-
Synonyms
High affinity immunoglobulin gamma Fc receptor I; Fcgr1; FcRI; CD64; Fc receptor; IgG; high affinity I
-
AA Sequence
VPAGAQTDPVKAVITLQPPWVSVFQEESVTLWCEGPHLPGDSSTQWFLNGTATQTLTPRYRIAAASVNDNGEYRCQTGLSVLSDPIQLGIHRDWLILQVSGRVFTEGEPLTLRCHGWNNKLVYNVLFYQNGTVLKFSPQNSEFTILKTTLHHNGIYHCSAMGKHRYESAGVSITIKELFPAPVLKASLSSPILEGHVVNLSCETKLLLQRPGLQLYFSFYMGSKTLLSRNTSSEYQILTAKKEDSGLYWCEATTEDGNVVKRSPELELQVVGPQTLTP
-
Predicted Molecular Mass
31.9 kDa
-
Molecular Weight
Approximately 44 kDa & 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
