1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. CD68
  5. CD68 Protein, Rat (HEK293, Fc)

CD68 is a protein belonging to the LAMP (lysosome-associated membrane protein) family. It is expressed primarily in macrophages, monocytes, and dendritic cells, serving as a marker for these immune cells. CD68 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD68 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD68 is a protein belonging to the LAMP (lysosome-associated membrane protein) family. It is expressed primarily in macrophages, monocytes, and dendritic cells, serving as a marker for these immune cells. CD68 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD68 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD68 is a protein that belongs to the LAMP (lysosome-associated membrane protein) family. It is primarily expressed in macrophages, monocytes, and dendritic cells, serving as a marker for these immune cells. CD68 is localized to the lysosomes, which are cellular organelles responsible for the degradation of various molecules. As a lysosomal protein, CD68 plays a crucial role in the processing and presentation of antigens by macrophages and dendritic cells. It is involved in phagocytosis, the process by which these immune cells engulf and digest foreign particles, such as bacteria and cellular debris. CD68 is also implicated in inflammation and tissue remodeling, as its expression can be upregulated in response to inflammatory stimuli. Furthermore, CD68 has been identified as a potential biomarker in certain diseases, including cancer, where its expression is associated with tumor progression and poor prognosis. Understanding the functions and implications of CD68 could provide valuable insights into immune responses and disease pathogenesis.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

Q4FZY1 (D21-S295)

Gene ID
Molecular Construction
N-term
CD68 (D21-S295)
Accession # Q4FZY1
hFc
C-term
Protein Length

Partial

Synonyms
CD68 antigenmacrophage antigen CD68; CD68; Gp110; Macrosialin; SRD1
AA Sequence

DCPHKKAATLLPSFTETPTTTGSTASPTTTHRPTTTSHRPTTTSHRPTTTSHRPTTTSHRPTTTSHRPTTTSHGNATVSPTTNSPGFSTVGPHPGPPPPSPSPSPSSTGALGNYTWTNGSQPCVQLQAQIQIRILYLTQGGKKAWGLSVLNPNKTKVQGGCDSAHPHLALSFPYGQLTFGFKQDRHQSHSTVYLNYMAVEYNVSFPQAAQWTFSAQNSSLQELQAPLGQSFCCGNTSIVLSPAIHLDLLSLRLQAAQLPDKGHFGPCFSCASDQS

Predicted Molecular Mass
56.5 kDa
Molecular Weight

Approximately 87-117 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD68 Protein, Rat (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD68 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P74277
Quantity:
MCE Japan Authorized Agent: