CD7 Protein, Human (HEK293, Llama Fc)

CD7 Protein, with an elusive function, interacts with SECTM1, implying involvement in SECTM1-related cellular processes. Further research is essential to uncover the specific functions and molecular pathways in which CD7 intricately participates. The current lack of detailed information emphasizes the ongoing exploration needed to elucidate CD7's functional significance and its interplay with SECTM1 in cellular contexts. CD7 Protein, Human (HEK293, Llama Fc) is the recombinant human-derived CD7 protein, expressed by HEK293, with C-Llama Fc labeled tag.

CD7 Protein, although its precise function remains elusive, is identified to interact with SECTM1. The nature of this interaction suggests a potential role for CD7 in cellular processes that involve SECTM1, emphasizing the need for further research to unravel the specific functions and molecular pathways in which CD7 is intricately involved. The current lack of detailed information underscores the ongoing exploration required to elucidate the functional significance of CD7 and its interplay with SECTM1 in cellular contexts.

Human

HEK293

C-Llama Fc

P09564 (A26-P180)

924

Extracellular Domain

AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP

Approximately 55-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.