1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. CD7 NK Cell CD Proteins Macrophage CD Proteins
  4. CD7 Protein, Mouse (HEK293, Fc)

CD7 protein's functional role remains unclear, with its specific cellular activities and interactions, particularly with SECTM1, yet to be fully elucidated. Further research is essential for a comprehensive understanding of CD7 protein's functional significance and its potential involvement in various cellular processes. CD7 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD7 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

CD7 protein's functional role remains unclear, with its specific cellular activities and interactions, particularly with SECTM1, yet to be fully elucidated. Further research is essential for a comprehensive understanding of CD7 protein's functional significance and its potential involvement in various cellular processes. CD7 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD7 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The functional role of CD7 protein is currently not fully elucidated, and its specific cellular activities remain unknown. However, it has been identified to interact with SECTM1, suggesting potential involvement in cellular processes mediated by this interaction. Further research is required to comprehensively understand the functional significance and biological activities associated with CD7 protein in cellular contexts.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P50283 (Q24-P150)

Gene ID
Molecular Construction
N-term
CD7 (Q24-P150)
Accession # P50283
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
CD7 molecule; CD7; LEU-9; Tp40; TP41; GP40
AA Sequence

QDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFP

Predicted Molecular Mass
41 kDa
분자량

Approximately 50-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

CD7 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD7 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD7 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P78261
수량:
MCE Japan Authorized Agent: