CD70 Protein, Human (HEK293, mFc)
As a ligand of CD27, CD70 protein is an indispensable part of T cell immune coordination and is of particular importance in antiviral responses. The CD70-CD27 pathway emerged as a key player that contributes to the generation and maintenance of T cell-mediated immune responses. CD70 Protein, Human (HEK293, mFc) is the recombinant human-derived CD70 protein, expressed by HEK293, with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
보관:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
제품 설명
As a ligand of CD27, CD70 protein is an indispensable part of T cell immune coordination and is of particular importance in antiviral responses. The CD70-CD27 pathway emerged as a key player that contributes to the generation and maintenance of T cell-mediated immune responses. CD70 Protein, Human (HEK293, mFc) is the recombinant human-derived CD70 protein, expressed by HEK293, with C-mFc labeled tag.
Background
CD70, a cytokine functioning as the ligand for CD27, is integral to the CD70-CD27 pathway, which holds a crucial role in the development and sustenance of T cell immunity, especially in antiviral responses. Upon binding to CD27, CD70 induces the proliferation of costimulated T-cells and amplifies the generation of cytolytic T-cells, contributing to an effective immune response. Structurally, CD70 forms homotrimers, reflecting its molecular organization. The CD70-CD27 interaction underscores its significance in orchestrating T cell-mediated immune responses, providing valuable insights into the regulation of immune functions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
P32970-1 (Q45-P193)
-
Gene ID970
-
Molecular Construction
-
N-term
-
CD70 (Q45-P193)
Accession # P32970-1 -
mFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CD70; Tumor Necrosis Factor Ligand Superfamily Member 7; Prev. CD27LG; Tumor Necrosis Factor Ligand 8A; Prev. TNFSF7; Surface Antigen CD70; CD70 Antigen; Ki-24 Antigen; CD27 Ligand; TNLG8A; CD27-L; LPFS3; CD27L; CD70 Molecule; Tumor Necrosis Factor (Ligan
-
AA Sequence
QQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
-
Predicted Molecular Mass
44 kDa
-
분자량
Approximately 50-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Monomer
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
각종 서류
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)