CD70 Protein, Human (HEK293, mFc)

As a ligand of CD27, CD70 protein is an indispensable part of T cell immune coordination and is of particular importance in antiviral responses. The CD70-CD27 pathway emerged as a key player that contributes to the generation and maintenance of T cell-mediated immune responses. CD70 Protein, Human (HEK293, mFc) is the recombinant human-derived CD70 protein, expressed by HEK293, with C-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

As a ligand of CD27, CD70 protein is an indispensable part of T cell immune coordination and is of particular importance in antiviral responses. The CD70-CD27 pathway emerged as a key player that contributes to the generation and maintenance of T cell-mediated immune responses. CD70 Protein, Human (HEK293, mFc) is the recombinant human-derived CD70 protein, expressed by HEK293, with C-mFc labeled tag.

Background

CD70, a cytokine functioning as the ligand for CD27, is integral to the CD70-CD27 pathway, which holds a crucial role in the development and sustenance of T cell immunity, especially in antiviral responses. Upon binding to CD27, CD70 induces the proliferation of costimulated T-cells and amplifies the generation of cytolytic T-cells, contributing to an effective immune response. Structurally, CD70 forms homotrimers, reflecting its molecular organization. The CD70-CD27 interaction underscores its significance in orchestrating T cell-mediated immune responses, providing valuable insights into the regulation of immune functions.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-mFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD70 (Q45-P193)
      Accession # P32970-1
    • mFc
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    CD70; Tumor Necrosis Factor Ligand Superfamily Member 7; Prev. CD27LG; Tumor Necrosis Factor Ligand 8A; Prev. TNFSF7; Surface Antigen CD70; CD70 Antigen; Ki-24 Antigen; CD27 Ligand; TNLG8A; CD27-L; LPFS3; CD27L; CD70 Molecule; Tumor Necrosis Factor (Ligan

  • AA Sequence

    QQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

  • Predicted Molecular Mass

    44 kDa

  • Molecular Weight

    Approximately 50-90 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Structure/Form

    Monomer

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00