CDNF Protein, Human (HEK293, Fc)
CDNF (cerebral dopamine neurotrophic factor) functions as an important trophic factor, providing unique support to dopamine neurons. Its protective effect has a clear role in preventing 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. CDNF Protein, Human (HEK293, Fc) is the recombinant human-derived CDNF protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CDNF (cerebral dopamine neurotrophic factor) functions as an important trophic factor, providing unique support to dopamine neurons. Its protective effect has a clear role in preventing 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. CDNF Protein, Human (HEK293, Fc) is the recombinant human-derived CDNF protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CDNF (Cerebral Dopamine Neurotrophic Factor) emerges as a vital trophic factor with a distinctive role in supporting dopamine neurons. Its protective capabilities extend to preventing the degeneration of dopaminergic neurons induced by 6-hydroxydopamine (6-OHDA). Notably, when administered subsequent to 6-OHDA-lesioning, CDNF exhibits the remarkable ability to restore dopaminergic function and effectively thwart the degeneration of neurons within the substantia nigra, underscoring its therapeutic potential in mitigating neurodegenerative processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q49AH0-1 (Q25-L187)
-
Molecular Construction
-
N-term
-
CDNF (Q25-L187)
Accession # Q49AH0-1 -
hFc
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CDNF; Conserved Dopamine Neurotrophic Factor; Prev. ARMETL1; ARMET-Like Protein 1; Cerebral Dopamine Neurotrophic Factor; Arginine-Rich, Mutated In Early Stage Tumors-Like 1
-
AA Sequence
QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL
-
Predicted Molecular Mass
45.2 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
