1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. CDNF/MANF family
  5. CDNF
  6. CDNF Protein, Human (HEK293, Fc)

CDNF (cerebral dopamine neurotrophic factor) functions as an important trophic factor, providing unique support to dopamine neurons. Its protective effect has a clear role in preventing 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. CDNF Protein, Human (HEK293, Fc) is the recombinant human-derived CDNF protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

CDNF (cerebral dopamine neurotrophic factor) functions as an important trophic factor, providing unique support to dopamine neurons. Its protective effect has a clear role in preventing 6-hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. CDNF Protein, Human (HEK293, Fc) is the recombinant human-derived CDNF protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CDNF (Cerebral Dopamine Neurotrophic Factor) emerges as a vital trophic factor with a distinctive role in supporting dopamine neurons. Its protective capabilities extend to preventing the degeneration of dopaminergic neurons induced by 6-hydroxydopamine (6-OHDA). Notably, when administered subsequent to 6-OHDA-lesioning, CDNF exhibits the remarkable ability to restore dopaminergic function and effectively thwart the degeneration of neurons within the substantia nigra, underscoring its therapeutic potential in mitigating neurodegenerative processes.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q49AH0-1 (Q25-L187)

Gene ID
Molecular Construction
N-term
CDNF (Q25-L187)
Accession # Q49AH0-1
hFc
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Cerebral dopamine neurotrophic factor; ARMET-like protein 1; ARMETL1
AA Sequence

QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL

Predicted Molecular Mass
45.2 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

CDNF Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CDNF Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CDNF Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76248
수량:
MCE Japan Authorized Agent: