Cephalosporin C deacetylase Protein, Bacillus subtilis

Cephalosporin C deacetylase Protein, an esterase, selectively removes acetyl groups from substrates like acetylated xylose and cephalosporin C. Its catalytic activity excludes polymeric acetylated xylan and amide linkages, highlighting its nuanced, targeted deacetylation function. Cephalosporin C deacetylase Protein, Bacillus subtilis is the recombinant Cephalosporin C deacetylase protein, expressed by E. coli , with tag free.

Cephalosporin C deacetylase protein functions as an esterase, selectively removing acetyl groups from various O-acetylated small substrates, including acetylated xylose, short xylooligosaccharides, and cephalosporin C. Notably, its catalytic activity does not extend to polymeric acetylated xylan, and it is incapable of cleaving amide linkages. This specificity underscores its role in the targeted deacetylation of specific substrates, emphasizing its nuanced enzymatic function.

Others

E. coli

Tag Free

P94388 (M1-G318)

938341

Full Length

MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQHLKG

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.