Cephalosporin C deacetylase Protein, Bacillus subtilis
Cephalosporin C deacetylase Protein, an esterase, selectively removes acetyl groups from substrates like acetylated xylose and cephalosporin C. Its catalytic activity excludes polymeric acetylated xylan and amide linkages, highlighting its nuanced, targeted deacetylation function. Cephalosporin C deacetylase Protein, Bacillus subtilis is the recombinant Cephalosporin C deacetylase protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Cephalosporin C deacetylase Protein, an esterase, selectively removes acetyl groups from substrates like acetylated xylose and cephalosporin C. Its catalytic activity excludes polymeric acetylated xylan and amide linkages, highlighting its nuanced, targeted deacetylation function. Cephalosporin C deacetylase Protein, Bacillus subtilis is the recombinant Cephalosporin C deacetylase protein, expressed by E. coli , with tag free.
Background
Cephalosporin C deacetylase protein functions as an esterase, selectively removing acetyl groups from various O-acetylated small substrates, including acetylated xylose, short xylooligosaccharides, and cephalosporin C. Notably, its catalytic activity does not extend to polymeric acetylated xylan, and it is incapable of cleaving amide linkages. This specificity underscores its role in the targeted deacetylation of specific substrates, emphasizing its nuanced enzymatic function.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
P94388 (M1-G318)
-
Gene ID938341
-
Molecular Construction
-
N-term
-
CAH (M1-G318)
Accession # P94388 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
BSU03180; cah; EC:3.1.1.72; Acetylxylan esterase; EC:3.1.1.41; Cephalosporin-C deacetylase
-
AA Sequence
MQLFDLPLDQLQTYKPEKTAPKDFSEFWKLSLEELAKVQAEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMVNWALHGYATFGMLVRGQQSSEDTSISPHGHALGWMTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIGVTGGSQGGGLTIAAAALSDIPKAAVADYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNLADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQHLKG
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
