1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. CHST11 Protein, Human (sf9, His)

CHST11 Protein catalyzes sulfate transfer to position 4 of the GalNAc residue in chondroitin, the main proteoglycan in cartilage and cell surfaces. It can sulfate Gal residues in desulfated dermatan sulfate, with a preference for GlcA->GalNAc units over IdoA->GalNAc units, and does not form 4,6-di-O-sulfated GalNAc when chondroitin sulfate C is the acceptor. CHST11 Protein, Human (sf9, His) is the recombinant human-derived CHST11 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CHST11 Protein catalyzes sulfate transfer to position 4 of the GalNAc residue in chondroitin, the main proteoglycan in cartilage and cell surfaces. It can sulfate Gal residues in desulfated dermatan sulfate, with a preference for GlcA->GalNAc units over IdoA->GalNAc units, and does not form 4,6-di-O-sulfated GalNAc when chondroitin sulfate C is the acceptor. CHST11 Protein, Human (sf9, His) is the recombinant human-derived CHST11 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

CHST11 protein serves as a catalyst in the sulfate transfer to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin, a critical step in the biosynthesis of chondroitin sulfate. Chondroitin sulfate is a prominent proteoglycan found in cartilage and widely distributed on cell surfaces and extracellular matrices. Additionally, CHST11 exhibits the ability to sulfate Gal residues in desulfated dermatan sulfate. Notably, it displays a preference for sulfating in the GlcA->GalNAc unit over the IdoA->GalNAc unit and does not generate 4, 6-di-O-sulfated GalNAc when utilizing chondroitin sulfate C as an acceptor. This specific sulfation activity contributes to the intricate and precise modification of chondroitin sulfate, underscoring CHST11's role in the regulation of cartilage composition and other extracellular matrices.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q9NPF2-2 (M36-E347)

Gene ID
Molecular Construction
N-term
CHST11 (M36-E347)
Accession # Q9NPF2-2
His
C-term
Protein Length

Partial

Synonyms
Carbohydrate sulfotransferase 11; Chondroitin 4-sulfotransferase 1; C4ST1
AA Sequence

MRRNPFGVDICCRKGSRSPLQELYNPIQLELSNTAVLHQMRRDQVTDTCRANSATSRKRRVLTPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLTGRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKFTQKYNISFHKRYGTKIIKRQRKNATQEALRKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLKLE

Predicted Molecular Mass
38.4 kDa
Molecular Weight

Approximately 43 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CHST11 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CHST11 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CHST11 Protein, Human (sf9, His)
Cat. No.:
HY-P76257
Quantity:
MCE Japan Authorized Agent: