CHST11 Protein, Human (sf9, His)
Based on 1 Customer Validation
CHST11 Protein catalyzes sulfate transfer to position 4 of the GalNAc residue in chondroitin, the main proteoglycan in cartilage and cell surfaces. It can sulfate Gal residues in desulfated dermatan sulfate, with a preference for GlcA->GalNAc units over IdoA->GalNAc units, and does not form 4,6-di-O-sulfated GalNAc when chondroitin sulfate C is the acceptor. CHST11 Protein, Human (sf9, His) is the recombinant human-derived CHST11 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CHST11 Protein catalyzes sulfate transfer to position 4 of the GalNAc residue in chondroitin, the main proteoglycan in cartilage and cell surfaces. It can sulfate Gal residues in desulfated dermatan sulfate, with a preference for GlcA->GalNAc units over IdoA->GalNAc units, and does not form 4,6-di-O-sulfated GalNAc when chondroitin sulfate C is the acceptor. CHST11 Protein, Human (sf9, His) is the recombinant human-derived CHST11 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
CHST11 protein serves as a catalyst in the sulfate transfer to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin, a critical step in the biosynthesis of chondroitin sulfate. Chondroitin sulfate is a prominent proteoglycan found in cartilage and widely distributed on cell surfaces and extracellular matrices. Additionally, CHST11 exhibits the ability to sulfate Gal residues in desulfated dermatan sulfate. Notably, it displays a preference for sulfating in the GlcA->GalNAc unit over the IdoA->GalNAc unit and does not generate 4, 6-di-O-sulfated GalNAc when utilizing chondroitin sulfate C as an acceptor. This specific sulfation activity contributes to the intricate and precise modification of chondroitin sulfate, underscoring CHST11's role in the regulation of cartilage composition and other extracellular matrices.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q9NPF2-2 (M36-E347)
-
Molecular Construction
-
N-term
-
CHST11 (M36-E347)
Accession # Q9NPF2-2 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CHST11; Chondroitin 4-O-Sulfotransferase 1; Carbohydrate Sulfotransferase 11; Chondroitin 4-Sulfotransferase 1; C4ST1; C4S-1; HSA269537; Carbohydrate Sulfotransferase; C4St-1; IgH/CHST11 Fusion; C4ST; C4ST-1; Carbohydrate (Chondroitin 4) Sulfotransferase
-
AA Sequence
MRRNPFGVDICCRKGSRSPLQELYNPIQLELSNTAVLHQMRRDQVTDTCRANSATSRKRRVLTPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLTGRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKFTQKYNISFHKRYGTKIIKRQRKNATQEALRKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLDFLMFNYSVPSYLKLE
-
Predicted Molecular Mass
38.4 kDa
-
Molecular Weight
Approximately 43 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, 10% glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
