Claudin-18/CLDN18.1 Protein, Human (sf9, His, Flag, Detergent)

Claudin-18/CLDN18.1 Protein, Human (sf9, His, Flag, Detergent) is supplied in a detergent-containing formulation. The detergent is essential for maintaining protein solubility, stability, and biological activity. Do not remove the detergent under any circumstances.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Biological Activity

Description

Claudin-18/CLDN18.1 Protein, Human (sf9, His, Flag, Detergent) is supplied in a detergent-containing formulation. The detergent is essential for maintaining protein solubility, stability, and biological activity. Do not remove the detergent under any circumstances.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-His;C-Flag
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • CLDN18 (M1-A200)
      Accession # P56856-1
    • Flag
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Claudin-18.1; CLDN18; Claudin-18

  • AA Sequence

    MSTTTCQVVAFLLSILGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGFTECRPYFTILGLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLTSGIMFIVSGLCAIAGVSVFANMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMMCIACRGLA

  • Predicted Molecular Mass

    40.9 kDa.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00