CLEC4E Protein, Mouse (His)

The CLEC4E protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the innate immune system. It recognizes DAMPs and PAMPs, including mycobacterial trehalose 6,6'-dimycolate (TDM). CLEC4E Protein, Mouse (His) is the recombinant mouse-derived CLEC4E protein, expressed by E. coli, with His-tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Biological Activity

Description

The CLEC4E protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the innate immune system. It recognizes DAMPs and PAMPs, including mycobacterial trehalose 6,6'-dimycolate (TDM). CLEC4E Protein, Mouse (His) is the recombinant mouse-derived CLEC4E protein, expressed by E. coli, with His-tag.

Background

CLEC4E, a calcium-dependent lectin, functions as a pattern recognition receptor (PRR) within the innate immune system, identifying damage-associated molecular patterns (DAMPs) associated with abnormal self and pathogen-associated molecular patterns (PAMPs) from bacteria and fungi. Notably, CLEC4E recognizes mycobacterial trehalose 6,6'-dimycolate (TDM), a potent adjuvant immunomodulatory glycolipid. Interacting with the signaling adapter Fc receptor gamma chain/FCER1G, CLEC4E forms a functional complex in myeloid cells. Binding of mycobacterial TDM to this receptor complex triggers the phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, leading to the activation of SYK, CARD9, and NF-kappa-B. Consequently, this drives the maturation of antigen-presenting cells and shapes antigen-specific priming of T-cells toward the effector T-helper 1 (Th1) and T-helper 17 (Th17) cell subtypes. Additionally, CLEC4E recognizes alpha-mannose residues on pathogenic fungi, such as Malassezia, mediating macrophage activation. Acting as a monomer and homodimer, CLEC4E also interacts with SAP130 nuclear protein released from necrotic cells, promoting immune sensing of damaged self and facilitating inflammatory cell infiltration into the damaged tissue. The versatility of CLEC4E underscores its pivotal role in immune surveillance and response mechanisms.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CLEC4E (T46-D214)
      Accession # Q9R0Q8
    • 6*His
    • C-term
  • Synonyms

    CLEC4E; Macrophage-Inducible C-Type Lectin; Prev. CLECSF9; C-Type Lectin Superfamily Member 9; MINCLE; C-Type Lectin Domain Family 4, Member E; C-Type Lectin Domain Family 4 Member E; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Sup

  • AA Sequence

    TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD

  • Predicted Molecular Mass

    23.6kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 500 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00