CLEC4E Protein, Mouse (His)
Based on 1 Customer Validation
The CLEC4E protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the innate immune system. It recognizes DAMPs and PAMPs, including mycobacterial trehalose 6,6'-dimycolate (TDM). CLEC4E Protein, Mouse (His) is the recombinant mouse-derived CLEC4E protein, expressed by E. coli, with His-tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CLEC4E protein is a calcium-dependent lectin that functions as a pattern recognition receptor in the innate immune system. It recognizes DAMPs and PAMPs, including mycobacterial trehalose 6,6'-dimycolate (TDM). CLEC4E Protein, Mouse (His) is the recombinant mouse-derived CLEC4E protein, expressed by E. coli, with His-tag.
Background
CLEC4E, a calcium-dependent lectin, functions as a pattern recognition receptor (PRR) within the innate immune system, identifying damage-associated molecular patterns (DAMPs) associated with abnormal self and pathogen-associated molecular patterns (PAMPs) from bacteria and fungi. Notably, CLEC4E recognizes mycobacterial trehalose 6,6'-dimycolate (TDM), a potent adjuvant immunomodulatory glycolipid. Interacting with the signaling adapter Fc receptor gamma chain/FCER1G, CLEC4E forms a functional complex in myeloid cells. Binding of mycobacterial TDM to this receptor complex triggers the phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, leading to the activation of SYK, CARD9, and NF-kappa-B. Consequently, this drives the maturation of antigen-presenting cells and shapes antigen-specific priming of T-cells toward the effector T-helper 1 (Th1) and T-helper 17 (Th17) cell subtypes. Additionally, CLEC4E recognizes alpha-mannose residues on pathogenic fungi, such as Malassezia, mediating macrophage activation. Acting as a monomer and homodimer, CLEC4E also interacts with SAP130 nuclear protein released from necrotic cells, promoting immune sensing of damaged self and facilitating inflammatory cell infiltration into the damaged tissue. The versatility of CLEC4E underscores its pivotal role in immune surveillance and response mechanisms.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
Q9R0Q8 (T46-D214)
-
Gene ID56619
-
Molecular Construction
-
N-term
-
CLEC4E (T46-D214)
Accession # Q9R0Q8 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLEC4E; Macrophage-Inducible C-Type Lectin; Prev. CLECSF9; C-Type Lectin Superfamily Member 9; MINCLE; C-Type Lectin Domain Family 4, Member E; C-Type Lectin Domain Family 4 Member E; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Superfamily Member 9
-
AA Sequence
TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD
-
Predicted Molecular Mass
23.6kDa
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 500 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)