CLEC9A Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
The CLEC9A protein is uniquely expressed on specific myeloid cells and acts as an endocytic receptor responsible for the uptake and processing of materials from dead cells. CLEC9A recognizes filamentous actin, especially in damaged cell membranes, and plays a critical role in Syk-dependent cross-presentation of dead cell antigens. CLEC9A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CLEC9A protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CLEC9A protein is uniquely expressed on specific myeloid cells and acts as an endocytic receptor responsible for the uptake and processing of materials from dead cells. CLEC9A recognizes filamentous actin, especially in damaged cell membranes, and plays a critical role in Syk-dependent cross-presentation of dead cell antigens. CLEC9A Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CLEC9A protein, expressed by HEK293 , with N-hFc labeled tag.
Background
The CLEC9A protein serves as an endocytic receptor, uniquely expressed on a specific subset of myeloid cells with a specialized role in the uptake and processing of material derived from dead cells. It recognizes the filamentous form of actin, particularly in conjunction with specific actin-binding domains of cytoskeletal proteins like spectrin, which become exposed upon cell membrane damage. CLEC9A plays a crucial role in the cross-presentation of antigens associated with dead cells in a Syk-dependent manner, contributing to immune surveillance and response. Structurally, it forms homodimers to execute its functions efficiently.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
Q8BRU4-4 (K57-I264)
-
Molecular Construction
-
N-term
-
hFc
-
CLEC9A (K57-I264)
Accession # Q8BRU4-4 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLEC9A; CD370; C-Type Lectin Domain Containing 9A; Dendritic Cell Natural Killer Lectin Group Receptor 1; C-Type Lectin Domain Family 9 Member A; DNGR1; HEEE9341; C-Type Lectin Domain Family 9, Member A; UNQ9341; CD370 Antigen; DNGR-1
-
AA Sequence
KFFQVSSLVLEQQERLIQQDTALVNLTQWQRKYTLEYCQALLQRSLHSGTDASTGPVLLTSPQMVPQTLDSKETGSDCSPCPHNWIQNGKSCYYVFERWEMWNISKKSCLKEGASLFQIDSKEEMEFISSIGKLKGGNKYWVGVFQDGISGSWFWEDGSSPLSDLLPAERQRSAGQICGYLKDSTLISDKCDSWKYFICEKKAFGSCI
-
Predicted Molecular Mass
52.1 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
