CLIP1 Protein, Human (His, Strep)
CLIP1 Protein, Human (His, Strep) is the recombinant human-derived CLIP1, expressed by E. coli , with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CLIP1 Protein, Human (His, Strep) is the recombinant human-derived CLIP1, expressed by E. coli , with Strep, His labeled tag.
Background
CLIP170 is a microtubule plus-end binding protein that regulates the dynamics of the microtubule cytoskeleton. It promotes microtubule growth and bundling, links cytoplasmic vesicles to microtubules, and plays a crucial role in intracellular vesicle trafficking. Additionally, CLIP170 is involved in macropinocytosis and endosome trafficking processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
P30622-3 (A181-T339)
-
Gene ID6249
-
Protein Length
Partial
-
Synonyms
CLIP1; CAP-Gly Domain-Containing Linker Protein 1; Prev. RSN; Cytoplasmic Linker Protein 1; CLIP-170; Restin; CYLN1; Reed-Sternberg Intermediate Filament-Associated Protein; CLIP170; Cytoplasmic Linker Protein CLIP-170; CLIP; CLIP1 Protein; Restin (Reed-S
-
AA Sequence
ATPPISNLTKTASESISNLSEAGSIKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVMATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTET
-
Predicted Molecular Mass
19.8 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
