COLAER_02088 Protein, Collinsella aerofaciens (T189V, V207M)

The COLAER_02088 Protein, acting as a 7beta-hydroxysteroid dehydrogenase, transforms 7-oxo-lithocholate into chemopreventive UDCA in the human colon, showcasing its role in bile acid metabolism. This enzyme also exhibits reversible reactions, oxidizing UDCA and utilizing NADPH as its preferred electron acceptor, influencing bile acid dynamics and potential therapeutic applications. COLAER_02088 Protein, Collinsella aerofaciens (T189V, V207M) is the recombinant COLAER_02088 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The COLAER_02088 Protein, acting as a 7beta-hydroxysteroid dehydrogenase, transforms 7-oxo-lithocholate into chemopreventive UDCA in the human colon, showcasing its role in bile acid metabolism. This enzyme also exhibits reversible reactions, oxidizing UDCA and utilizing NADPH as its preferred electron acceptor, influencing bile acid dynamics and potential therapeutic applications. COLAER_02088 Protein, Collinsella aerofaciens (T189V, V207M) is the recombinant COLAER_02088 protein, expressed by E. coli , with tag free.

Background

The COLAER_02088 Protein, known as 7beta-hydroxysteroid dehydrogenase, acts as an enzyme that facilitates the reduction of the 7-oxo group of 7-oxo-lithocholate (7-oxo-LCA), resulting in the production of ursodeoxycholate (UDCA). Given that C.aerofaciens is an intestinal bacterium, it is likely that this enzyme plays a role in the formation of UDCA in the human colon. UDCA is considered a beneficial secondary bile acid with chemopreventive properties due to its low hydrophobicity, which helps safeguard hepatocytes and bile duct epithelial cells against necrosis and apoptosis induced by more hydrophobic secondary bile acids such as deoxycholate (DCA) (Probable). Additionally, this enzyme has the ability to catalyze the reverse reaction, oxidizing the 7beta-hydroxy group of UDCA back to 7-oxo-LCA. It also exhibits some activity on the taurine- and glycine-conjugates of ursodeoxycholate, albeit to a lesser extent. Notably, COLAER_02088 Protein specifically utilizes NADPH/NADP(+) as the electron acceptor/donor, as it is not active with NADH/NAD(+). Furthermore, when NADPH is present, 7beta-HSDH can also reduce dehydrocholate. Lastly, it has been shown to have the capability to oxidize ursocholate.

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • COLAER_02088 (M1-D263, T189V, V207M)
      Accession # A4ECA9
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    7beta-hydroxysteroid dehydrogenase; EC:1.1.1.201; 7beta-HSDH; NADP-dependent 7beta-hydroxysteroid dehydrogenase; COLAER_02088

  • AA Sequence

    MNLREKYGEWGLILGATEGVGKAFCEKIAAGGMNVVMVGRREEKLNVLAGEIRETYGVETKVVRADFSQPGAAETVFAATEGLDMGFMSYVACLHSFGKIQDTPWEKHEAMINVNVVTFLKCFHHYMRIFAAQDRGAVINVSSMTGISSSPWNGQYGAGKAFILKMTEAVACECEGTGVDVEVITLGTVLTPSLLSNLPGGPQGEAMMKIALTPEECVDEAFEKLGKELSVIAGQRNKDSVHDWKANHTEDEYIRYMGSFYRD

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00