COLAER_02088 Protein, Collinsella aerofaciens (T189V, V207M)
The COLAER_02088 Protein, acting as a 7beta-hydroxysteroid dehydrogenase, transforms 7-oxo-lithocholate into chemopreventive UDCA in the human colon, showcasing its role in bile acid metabolism. This enzyme also exhibits reversible reactions, oxidizing UDCA and utilizing NADPH as its preferred electron acceptor, influencing bile acid dynamics and potential therapeutic applications. COLAER_02088 Protein, Collinsella aerofaciens (T189V, V207M) is the recombinant COLAER_02088 protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The COLAER_02088 Protein, acting as a 7beta-hydroxysteroid dehydrogenase, transforms 7-oxo-lithocholate into chemopreventive UDCA in the human colon, showcasing its role in bile acid metabolism. This enzyme also exhibits reversible reactions, oxidizing UDCA and utilizing NADPH as its preferred electron acceptor, influencing bile acid dynamics and potential therapeutic applications. COLAER_02088 Protein, Collinsella aerofaciens (T189V, V207M) is the recombinant COLAER_02088 protein, expressed by E. coli , with tag free.
Background
The COLAER_02088 Protein, known as 7beta-hydroxysteroid dehydrogenase, acts as an enzyme that facilitates the reduction of the 7-oxo group of 7-oxo-lithocholate (7-oxo-LCA), resulting in the production of ursodeoxycholate (UDCA). Given that C.aerofaciens is an intestinal bacterium, it is likely that this enzyme plays a role in the formation of UDCA in the human colon. UDCA is considered a beneficial secondary bile acid with chemopreventive properties due to its low hydrophobicity, which helps safeguard hepatocytes and bile duct epithelial cells against necrosis and apoptosis induced by more hydrophobic secondary bile acids such as deoxycholate (DCA) (Probable). Additionally, this enzyme has the ability to catalyze the reverse reaction, oxidizing the 7beta-hydroxy group of UDCA back to 7-oxo-LCA. It also exhibits some activity on the taurine- and glycine-conjugates of ursodeoxycholate, albeit to a lesser extent. Notably, COLAER_02088 Protein specifically utilizes NADPH/NADP(+) as the electron acceptor/donor, as it is not active with NADH/NAD(+). Furthermore, when NADPH is present, 7beta-HSDH can also reduce dehydrocholate. Lastly, it has been shown to have the capability to oxidize ursocholate.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
A4ECA9 (M1-D263, T189V, V207M)
-
Gene ID/
-
Molecular Construction
-
N-term
-
COLAER_02088 (M1-D263, T189V, V207M)
Accession # A4ECA9 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
7beta-hydroxysteroid dehydrogenase; EC:1.1.1.201; 7beta-HSDH; NADP-dependent 7beta-hydroxysteroid dehydrogenase; COLAER_02088
-
AA Sequence
MNLREKYGEWGLILGATEGVGKAFCEKIAAGGMNVVMVGRREEKLNVLAGEIRETYGVETKVVRADFSQPGAAETVFAATEGLDMGFMSYVACLHSFGKIQDTPWEKHEAMINVNVVTFLKCFHHYMRIFAAQDRGAVINVSSMTGISSSPWNGQYGAGKAFILKMTEAVACECEGTGVDVEVITLGTVLTPSLLSNLPGGPQGEAMMKIALTPEECVDEAFEKLGKELSVIAGQRNKDSVHDWKANHTEDEYIRYMGSFYRD
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)