Complement C5a Protein, Mouse (His)
Based on 1 Customer Validation
Complement C5a Protein, Mouse (His) is a recombinant mouse complement component 5a (C5a). C5a is a potent pro-inflammatory mediator and acts as an essential part of the innate immune response.
- Species: Mouse
- Source: E. coli
-
Stockage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Activité biologique
Complement C5a Protein, Mouse (His) is a recombinant mouse complement component 5a (C5a). C5a is a potent pro-inflammatory mediator and acts as an essential part of the innate immune response[1].
Complement component 5a (C5a), a 74 amino acid glycoprotein, is a potent pro-inflammatory mediator cleaved enzy matically from its precursor, C5, upon activation of the complement cascade[1].
Measured by its ability to induce N-acetyl-beta-D-glucosaminidase release from differentiated U937 human histiocytic lymphoma cells. The ED50 for this effect is 6.447 ng/mL, corresponding to a specific activity is 1.551×105 units/mg.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P06684 (N679-R755)
-
Gene ID15139
-
Molecular Construction
-
N-term
-
6*His
-
C5a (N679-R755)
Accession # P06684 -
C-term
-
-
Protein Length
Partial
-
Synonyms
rMuC5a; Complement C5; Hemolytic Complement; C5a
-
AA Sequence
NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR
-
Masse moléculaire
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Pureté
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% trehalose, 0.02% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Fiche technique (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Instruction de manipulation (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
