CRISP-1 Protein, Mouse (HEK293, Fc)
CRISP-1 protein plays a crucial role in promoting the functional maturation of spermatozoa during their transition from the testis to the ductus deferens. Its involvement underscores its significance in the complex regulatory network governing male reproductive physiology, emphasizing its potential impact on sperm functionality and fertility as these cells navigate through the reproductive tract. CRISP-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CRISP-1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CRISP-1 protein plays a crucial role in promoting the functional maturation of spermatozoa during their transition from the testis to the ductus deferens. Its involvement underscores its significance in the complex regulatory network governing male reproductive physiology, emphasizing its potential impact on sperm functionality and fertility as these cells navigate through the reproductive tract. CRISP-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CRISP-1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CRISP-1 protein is implicated in facilitating the functional maturation of spermatozoa during their transit from the testis to the ductus deferens. This suggests a crucial role for CRISP-1 in the intricate processes associated with sperm development and maturation. As these cells navigate through the reproductive tract, CRISP-1 is thought to play a pivotal role in promoting the necessary changes that contribute to the acquisition of functional capabilities by spermatozoa. The involvement of CRISP-1 underscores its significance in the complex regulatory network governing male reproductive physiology, emphasizing its potential impact on sperm functionality and fertility.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q03401 (Q20-H244)
-
Molecular Construction
-
N-term
-
CRISP-1 (Q20-H244)
Accession # Q03401 -
hFc
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CRISP1; HUMARP; Prev. AEGL1; Acidic Epididymal Glycoprotein-Like 1; CRISP-1; Epididymis Secretory Protein Li 57; ARP; AEG-Like Protein; Cysteine-Rich Secretory Protein 1; Cysteine-Rich Secretory Protein-1 Delta; HSCRISP1D; AEG-Related Protein; HSCRISP1G;
-
AA Sequence
QDSSQENRLEKLSTTKMSVQEEIVSKHNQLRRMVSPSGSDLLKMEWNYDAQVNAQQWADKCTFSHSPIELRTTNLRCGENLFMSSYLASWSSAIQGWYNEYKDLTYDVGPKQPDSVVGHYTQVVWNSTFQVACGVAECPKNPLRYYYVCHYCPVGNYQGRLYTPYTAGEPCASCPDHCEDGLCTNSCGHEDKYTNCKYLKKMLSCEHELLKKGCKATCLCEGKIH
-
Predicted Molecular Mass
52.4 kDa
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
