CSAG1 Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
CSAG1 Protein is a potential key player in maintaining centrosome integrity during mitosis, impacting chromosome segregation. The mechanisms underlying its contribution to centrosome stability require elucidation. Its putative involvement highlights significance in mitosis-related cellular events. Further research is essential to unravel precise details of CSAG1's function and its implications for centrosome integrity during mitosis. CSAG1 Protein, Human (HEK293, Fc) is the recombinant human-derived CSAG1 protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CSAG1 Protein is a potential key player in maintaining centrosome integrity during mitosis, impacting chromosome segregation. The mechanisms underlying its contribution to centrosome stability require elucidation. Its putative involvement highlights significance in mitosis-related cellular events. Further research is essential to unravel precise details of CSAG1's function and its implications for centrosome integrity during mitosis. CSAG1 Protein, Human (HEK293, Fc) is the recombinant human-derived CSAG1 protein, expressed by HEK293 , with N-hFc labeled tag.
Background
CSAG1 Protein emerges as a potential key player, suggesting its crucial role in maintaining centrosome integrity during mitosis. The specific mechanisms and molecular interactions through which CSAG1 contributes to the intricate processes associated with centrosome stability remain to be fully elucidated. Its putative involvement underscores its significance in cellular events related to mitosis, indicating a potential impact on the proper segregation of chromosomes and overall cell division. Further research is essential to unravel the precise details of CSAG1's function and its implications in ensuring the integrity and functionality of centrosomes during the dynamic process of mitosis.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
Q6PB30-1 (D20-P78)
-
Molecular Construction
-
N-term
-
hFc
-
CSAG1 (D20-P78)
Accession # Q6PB30 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CSAG1; Chondrosarcoma-Associated Gene 1 Protein; Chondrosarcoma Associated Gene 1; Cancer/Testis Antigen CSAGE; CT24.1; Cancer/Testis Antigen 24.1; CSAGE; Putative Chondrosarcoma-Associated Gene 1 Protein; Cancer/Testis Antigen Family 24, Member 1
-
AA Sequence
DQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPRREKGPVKEVPGTKGSP
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
