CTLA-4 Protein, Cynomolgus (HEK293, hFc)
CTLA-4 Protein, a pivotal inhibitory receptor, is a primary negative modulator of T-cell responses in immune regulation. Its distinctive property lies in significantly higher affinity for B7 ligands (CD80/CD86) than the stimulatory coreceptor CD28. Outcompeting CD28 for ligand engagement, CTLA-4 exerts a suppressive influence on T-cell activation, mitigating excessive immune responses in the intricate landscape of immune regulation. CTLA-4 Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived CTLA-4 protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CTLA-4 Protein, a pivotal inhibitory receptor, is a primary negative modulator of T-cell responses in immune regulation. Its distinctive property lies in significantly higher affinity for B7 ligands (CD80/CD86) than the stimulatory coreceptor CD28. Outcompeting CD28 for ligand engagement, CTLA-4 exerts a suppressive influence on T-cell activation, mitigating excessive immune responses in the intricate landscape of immune regulation. CTLA-4 Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived CTLA-4 protein, expressed by HEK293, with C-hFc labeled tag.
Background
CTLA-4, a pivotal inhibitory receptor, assumes a paramount role as a primary negative modulator of T-cell responses within the intricate landscape of immune regulation. This regulatory function hinges on the distinctive property of CTLA-4 to exhibit significantly higher affinity for its natural B7 family ligands, CD80 and CD86, in comparison to the cognate stimulatory coreceptor CD28. This pronounced difference in binding affinity underscores the capacity of CTLA-4 to outcompete CD28 for ligand engagement, thereby exerting a suppressive influence on T-cell activation and mitigating excessive immune responses.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-hFc
-
Accession
G7PL88 (A37-S160)
-
Gene ID/
-
Molecular Construction
-
N-term
-
CTLA-4 (A37-S160)
Accession # G7PL88 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CTLA4; Celiac Disease 3; Prev. CELIAC3; Cytotoxic T Lymphocyte Associated Antigen 4 Short Spliced Form; Prev. IDDM12; Cytotoxic T-Lymphocyte-Associated Serine Esterase-4; CTLA-4; Cytotoxic T-Lymphocyte-Associated Protein 4; CD152; Cytotoxic T-Lymphocyte A
-
AA Sequence
AMHVAQPAVVLANSRGTASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDS
-
Predicted Molecular Mass
39.9 kDa
-
Molecular Weight
Approximately 42-50 kDa under reduced (R) conditions, 80-100 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
