1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CTLA-4
  5. CTLA-4 Protein, Cynomolgus (HEK293, hFc)

CTLA-4 Protein, a pivotal inhibitory receptor, is a primary negative modulator of T-cell responses in immune regulation. Its distinctive property lies in significantly higher affinity for B7 ligands (CD80/CD86) than the stimulatory coreceptor CD28. Outcompeting CD28 for ligand engagement, CTLA-4 exerts a suppressive influence on T-cell activation, mitigating excessive immune responses in the intricate landscape of immune regulation. CTLA-4 Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived CTLA-4 protein, expressed by HEK293, with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CTLA-4 Protein, a pivotal inhibitory receptor, is a primary negative modulator of T-cell responses in immune regulation. Its distinctive property lies in significantly higher affinity for B7 ligands (CD80/CD86) than the stimulatory coreceptor CD28. Outcompeting CD28 for ligand engagement, CTLA-4 exerts a suppressive influence on T-cell activation, mitigating excessive immune responses in the intricate landscape of immune regulation. CTLA-4 Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived CTLA-4 protein, expressed by HEK293, with C-hFc labeled tag.

Background

CTLA-4, a pivotal inhibitory receptor, assumes a paramount role as a primary negative modulator of T-cell responses within the intricate landscape of immune regulation. This regulatory function hinges on the distinctive property of CTLA-4 to exhibit significantly higher affinity for its natural B7 family ligands, CD80 and CD86, in comparison to the cognate stimulatory coreceptor CD28. This pronounced difference in binding affinity underscores the capacity of CTLA-4 to outcompete CD28 for ligand engagement, thereby exerting a suppressive influence on T-cell activation and mitigating excessive immune responses.

Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

G7PL88 (A37-S160)

Gene ID

/

Molecular Construction
N-term
CTLA-4 (A37-S160)
Accession # G7PL88
hFc
C-term
Protein Length

Partial

Synonyms
rCynCytotoxic T-lymphocyte protein 4/CTLA-4, His; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD152; CTLA4
AA Sequence

AMHVAQPAVVLANSRGTASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDS

Predicted Molecular Mass
39.9 kDa
Molecular Weight

Approximately 42-50 kDa,based on SDS-PAGE under reducing conditions,80-100 kDa,based on SDS-PAGE under non-reduced conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of 50 mM Tris, 100 mM Glycine, pH7.5 with trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CTLA-4 Protein, Cynomolgus (HEK293, hFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTLA-4 Protein, Cynomolgus (HEK293, hFc)
Cat. No.:
HY-P704300
Quantity:
MCE Japan Authorized Agent: