1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. CXCL14
  6. CXCL14/BRAK Protein, Rat (N-His)

BRAK14 is a CXC chemokine constitutively expressed at the mRNA level in certain normal tissues. CXCL14/BRAK Protein, Rat (N-His) is the recombinant rat-derived CXCL14/BRAK protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

BRAK14 is a CXC chemokine constitutively expressed at the mRNA level in certain normal tissues. CXCL14/BRAK Protein, Rat (N-His) is the recombinant rat-derived CXCL14/BRAK protein, expressed by E. coli , with N-6*His labeled tag.

Background

CXCL14/BRAK belongs to the cytokine gene family which encodes secreted proteins involved in immunoregulatory and inflammatory processes. CXCL14/BRAK encoded the protein which is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. CXCL14/BRAK displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. CXCL14/BRAK is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation[1][2][3][4][5].

Biological Activity

The biological activity determined by a chemotaxis bioassay using THP-1 Human monocytic leukemia cells. The ED50 for this effect is1.043 ng/mL, corresponding to a specific activity is 9.59×105 units/mg.

  • The biological activity determined by a chemotaxis bioassay using THP-1 Human monocytic leukemia cells. The ED50 for this effect is1.043 ng/mL, corresponding to a specific activity is 9.59×105 units/mg.
Species

Rat

Source

E. coli

Tag

N-6*His

Accession

Q8K453 (S23-E99)

Gene ID
Molecular Construction
N-term
6*His
Cxcl14 (S23-E99)
Accession # Q8K453
C-term
Protein Length

Full Length of Mature Protein

Synonyms
BRAK; CXCL14
AA Sequence

SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Predicted Molecular Mass
9.5 kDa
Molecular Weight

Approximately12 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

CXCL14/BRAK Protein, Rat (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CXCL14/BRAK Protein, Rat (N-His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CXCL14/BRAK Protein, Rat (N-His)
Cat. No.:
HY-P700280
Quantity:
MCE Japan Authorized Agent: