CXCL14/BRAK Protein, Rat (N-His)

BRAK14 is a CXC chemokine constitutively expressed at the mRNA level in certain normal tissues. CXCL14/BRAK Protein, Rat (N-His) is the recombinant rat-derived CXCL14/BRAK protein, expressed by E. coli , with N-6*His labeled tag.

CXCL14/BRAK belongs to the cytokine gene family which encodes secreted proteins involved in immunoregulatory and inflammatory processes. CXCL14/BRAK encoded the protein which is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. CXCL14/BRAK displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. CXCL14/BRAK is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation^{[1][2][3][4][5]}.

The biological activity determined by a chemotaxis bioassay using THP-1 Human monocytic leukemia cells. The ED₅₀ for this effect is1.043 ng/mL, corresponding to a specific activity is 9.59×10⁵ units/mg.

• 
  The biological activity determined by a chemotaxis bioassay using THP-1 Human monocytic leukemia cells. The ED₅₀ for this effect is1.043 ng/mL, corresponding to a specific activity is 9.59×10⁵ units/mg.

Rat

E. coli

N-6*His

Q8K453 (S23-E99)

306748  [NCBI]

Full Length of Mature Protein

SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Approximately12 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Chang TM, et al. CXCL14 promotes metastasis of non-small cell lung cancer through ACKR2-depended signaling pathway. Int J Biol Sci. 2023 Feb 27;19(5):1455-1470.  [Content Brief]

  [2]. Du L, et al. Elevated CXCL14 in Induced Sputum Was Associated with Eosinophilic Inflammation and Airway Obstruction in Patients with Asthma. Int Arch Allergy Immunol. 2022;183(11):1216-1225.  [Content Brief]

  [3]. Kumar A, et al. CXCL14 Promotes a Robust Brain Tumor-Associated Immune Response in Glioma. Clin Cancer Res. 2022 Jul 1;28(13):2898-2910.  [Content Brief]

  [4]. Liu D, et al. Integrated analysis of 14 lymphoma datasets revealed high expression of CXCL14 promotes cell migration in mantle cell lymphoma. Aging (Albany NY). 2022 Apr 22;14(8):3446-3463.  [Content Brief]

  [5]. Guo J, et al. Dysregulation of CXCL14 promotes malignant phenotypes of esophageal squamous carcinoma cells via regulating SRC and EGFR signaling. Biochem Biophys Res Commun. 2022 Jun 18;609:75-83.  [Content Brief]