CXCL14/BRAK Protein, Rat (N-His)

Customer Review

Based on 1 Customer Validation

BRAK14 is a CXC chemokine constitutively expressed at the mRNA level in certain normal tissues. CXCL14/BRAK Protein, Rat (N-His) is the recombinant rat-derived CXCL14/BRAK protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

BRAK14 is a CXC chemokine constitutively expressed at the mRNA level in certain normal tissues. CXCL14/BRAK Protein, Rat (N-His) is the recombinant rat-derived CXCL14/BRAK protein, expressed by E. coli , with N-6*His labeled tag.

Background

CXCL14/BRAK belongs to the cytokine gene family which encodes secreted proteins involved in immunoregulatory and inflammatory processes. CXCL14/BRAK encoded the protein which is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. CXCL14/BRAK displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. CXCL14/BRAK is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation[1][2][3][4][5].

Verified Bioactivity

The biological activity determined by a chemotaxis bioassay using THP-1 Human monocytic leukemia cells. The ED50 for this effect is1.043 ng/mL, corresponding to a specific activity is 9.59×105 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    The biological activity determined by a chemotaxis bioassay using THP-1 Human monocytic leukemia cells. The ED50 for this effect is1.043 ng/mL, corresponding to a specific activity is 9.59×105 units/mg.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • Cxcl14 (S23-E99)
      Accession # Q8K453
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL14; Kec; Prev. SCYB14; Small Inducible Cytokine Subfamily B (Cys-X-Cys), Member 14 (BRAK); NJAC; Chemokine (C-X-C Motif) Ligand 14; Small-Inducible Cytokine B14; Breast And Kidney; C-X-C Motif Chemokine 14; MIP-2G; Chemokine BRAK; MIP2G; Bolekine; CXC

  • AA Sequence

    SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

  • Predicted Molecular Mass

    9.5 kDa

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00