CYBB/Nox2 Protein, Human (His)
Based on 1 Customer Validation
The CYBB/Nox2 protein is an important membrane-bound oxidase in phagocytes and is critical for superoxide production. As the terminal element of the respiratory chain, it transfers a single electron from NADPH to molecular oxygen. CYBB/Nox2 Protein, Human (His) is the recombinant human-derived CYBB/Nox2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The CYBB/Nox2 protein is an important membrane-bound oxidase in phagocytes and is critical for superoxide production. As the terminal element of the respiratory chain, it transfers a single electron from NADPH to molecular oxygen. CYBB/Nox2 Protein, Human (His) is the recombinant human-derived CYBB/Nox2 protein, expressed by E. coli , with N-6*His labeled tag.
CYBB/Nox2 protein serves as a crucial component of the membrane-bound oxidase found in phagocytes, playing a pivotal role in the generation of superoxide. As the terminal element of a respiratory chain, it facilitates the transfer of single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Additionally, CYBB/Nox2 operates as a voltage-gated proton channel, orchestrating H(+) currents in resting phagocytes. Its involvement extends to the regulation of cellular pH, and notably, this function is modulated by zinc, which serves as a blocking agent for the channel. The multifaceted activities of CYBB/Nox2 underscore its significance in the intricate cellular processes associated with oxidative and protonic regulation within phagocytes.
Measured by its binding ability in a functional ELISA. Immobilized Human CYBB at 2 μg/mL can bind Anti-CYBB antibody. The ED50 for this effect is 25.87 ng/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P04839 (E283-F570)
-
Molecular Construction
-
N-term
-
6*His
-
CYBB (E283-F570)
Accession # P04839 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CYBB; P91-PHOX; Prev. CGD; Gp91-Phox; Cytochrome B-245 Heavy Chain; Gp91-1; NADPH Oxidase 2; Cytochrome B-245 Beta Polypeptide Isoform 2; NOX2; Cytochrome B-245, Beta Polypeptide; Heme-Binding Membrane Glycoprotein Gp91phox; Cytochrome B-245 Beta Polypept
-
AA Sequence
ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
-
Predicted Molecular Mass
37.2 kDa
-
Molecular Weight
Approximately 34-37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
