CYBB/Nox2 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The CYBB/Nox2 protein is an important membrane-bound oxidase in phagocytes and is critical for superoxide production. As the terminal element of the respiratory chain, it transfers a single electron from NADPH to molecular oxygen. CYBB/Nox2 Protein, Human (His) is the recombinant human-derived CYBB/Nox2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CYBB/Nox2 protein is an important membrane-bound oxidase in phagocytes and is critical for superoxide production. As the terminal element of the respiratory chain, it transfers a single electron from NADPH to molecular oxygen. CYBB/Nox2 Protein, Human (His) is the recombinant human-derived CYBB/Nox2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

CYBB/Nox2 protein serves as a crucial component of the membrane-bound oxidase found in phagocytes, playing a pivotal role in the generation of superoxide. As the terminal element of a respiratory chain, it facilitates the transfer of single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Additionally, CYBB/Nox2 operates as a voltage-gated proton channel, orchestrating H(+) currents in resting phagocytes. Its involvement extends to the regulation of cellular pH, and notably, this function is modulated by zinc, which serves as a blocking agent for the channel. The multifaceted activities of CYBB/Nox2 underscore its significance in the intricate cellular processes associated with oxidative and protonic regulation within phagocytes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CYBB at 2 μg/mL can bind Anti-CYBB antibody. The ED50 for this effect is 25.87 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human CYBB at 2 μg/mL can bind Anti-CYBB antibody. The ED50 for this effect is 25.87 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CYBB (E283-F570)
      Accession # P04839
    • C-term
  • Protein Length

    Cytoplasmic Domain

  • Synonyms

    CYBB; P91-PHOX; Prev. CGD; Gp91-Phox; Cytochrome B-245 Heavy Chain; Gp91-1; NADPH Oxidase 2; Cytochrome B-245 Beta Polypeptide Isoform 2; NOX2; Cytochrome B-245, Beta Polypeptide; Heme-Binding Membrane Glycoprotein Gp91phox; Cytochrome B-245 Beta Polypept

  • AA Sequence

    ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF

  • Predicted Molecular Mass

    37.2 kDa

  • Molecular Weight

    Approximately 34-37 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00