CYTH2 Protein, Human (His, Strep)
Based on 1 Customer Validation
CYTH2 Protein, Human (His, Strep) is the recombinant human-derived CYTH2, expressed by E. coli , with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CYTH2 Protein, Human (His, Strep) is the recombinant human-derived CYTH2, expressed by E. coli , with Strep, His labeled tag.
CYTH2 acts as a guanine-nucleotide exchange factor (GEF) that promotes guanine-nucleotide exchange on ARF1, ARF3, and ARF6. It activates ARF factors by replacing GDP with GTP (by similar). The cell membrane form of CYTH2, in association with ARL4 proteins, recruits ARF6 to the plasma membrane (PubMed:17398095). It is also involved in neurite growth (by similar).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-Strep
-
Accession
Q99418-1 (M1-P400)
-
Gene ID9266
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CYTH2; Pleckstrin Homology, Sec7 And Coiled/Coil Domains 2 (Cytohesin-2); Prev. PSCD2; ARF Nucleotide-Binding Site Opener; Prev. PSCD2L; ARF Exchange Factor; Cytohesin-2; Pleckstrin Homology, Sec7 And Coiled-Coil Domains 2 (Cytohesin-2), Isoform CRA_c; AR
-
AA Sequence
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
-
Predicted Molecular Mass
49.8 kDa
-
Molecular Weight
Approximately 49 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 200 mM NaCl, 20% glycerol, 1 mM DTT, pH 7.5.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
