Cytosolic beta-Glucosidase/GBA3 Protein, Human (GST)
Cytosolic β-glucosidase/GBA3 is a multifunctional neutral cytosolic β-glucosidase that displays broad substrate specificity, suggesting a possible involvement in glycosylceramide catabolism. Although it exhibits significant glucosylceramidase activity in vitro, its in vivo relevance is unclear. Cytosolic beta-Glucosidase/GBA3 Protein, Human (GST) is the recombinant human-derived Cytosolic beta-Glucosidase/GBA3 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Cytosolic β-glucosidase/GBA3 is a multifunctional neutral cytosolic β-glucosidase that displays broad substrate specificity, suggesting a possible involvement in glycosylceramide catabolism. Although it exhibits significant glucosylceramidase activity in vitro, its in vivo relevance is unclear. Cytosolic beta-Glucosidase/GBA3 Protein, Human (GST) is the recombinant human-derived Cytosolic beta-Glucosidase/GBA3 protein, expressed by E. coli , with N-GST labeled tag.
Background
Cytosolic beta-Glucosidase/GBA3, characterized as a neutral cytosolic beta-glycosidase, exhibits a broad substrate specificity, suggesting potential involvement in the catabolism of glycosylceramides. While demonstrating significant glucosylceramidase activity in vitro, its in vivo relevance remains unclear. The enzyme also hydrolyzes galactosylceramides/GalCers, glucosylsphingosines/GlcSphs, and galactosylsphingosines/GalSphs, although the physiological importance of these activities is not fully elucidated. Furthermore, Cytosolic beta-Glucosidase/GBA3 displays transxylosylase activity in vitro, utilizing xylosylated ceramides/XylCers as donors and cholesterol as an acceptor. Notably, the enzyme exhibits versatility in hydrolyzing various dietary glycosides, including phytoestrogens, flavonols, flavones, flavanones, and cyanogens, suggesting a potential role in xenobiotic metabolism. Additionally, it may contribute to the catabolism of cytosolic sialyl free N-glycans.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q9H227-2 (M1-L162)
-
Molecular Construction
-
N-term
-
GST
-
GBA3 (M1-L162)
Accession # Q9H227-2 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
GBA3; Cytosolic Beta-Glucosidase-Like Protein 1; Glucosylceramidase Beta 3 (Gene/Pseudogene); Glucosidase, Beta, Acid 3 (Cytosolic); CBGL1; Glucosidase Beta Acid 3; KLrP; Cytosolic GCase; Cytosolic Galactosylceramidase; CBG; Cytosolic Glucosylceramidase;
-
AA Sequence
MAFPAGFGWAAATAAYQVEGGWDADGKGPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFSLSWSRLLPDGTTGFINQKAIQLDKVNLQVYCAWSLLDNFEWNQGYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAHL
-
Predicted Molecular Mass
45.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
