DFF45/ICAD Protein, Human (His)
Based on 1 Customer Validation
DFF45/ICAD Protein, Human (His) is the recombinant human-derived DFF45/ICAD protein, expressed by E. coli, with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
DFF45/ICAD Protein, Human (His) is the recombinant human-derived DFF45/ICAD protein, expressed by E. coli, with N-6*His labeled tag.
DFF45/ICAD is an inhibitor of the caspase-activated DNase (DFF40), which regulates DNA fragmentation during apoptosis by binding and inhibiting DFF40 activity.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
AAH07721.1 (M1-T331)
-
Molecular Construction
-
N-term
-
6*His
-
DFF45 (M1-T331)
Accession # AAH07721.1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
DFFA; DNA Fragmentation Factor, 45kDa, Alpha Polypeptide; DNA Fragmentation Factor Subunit Alpha; DNA Fragmentation Factor 45 KDa Subunit; DFF-45; Inhibitor Of CAD; DFF45; DNA Fragmentation Factor, 45 KD, Alpha Polypeptide; ICAD; DNA Fragmentation Factor,
-
AA Sequence
MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
-
Predicted Molecular Mass
38.7 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
