DFFA Protein, Human (GST)
DFFA Protein is a heterodimeric complex of nuclease CAD and its specific inhibitor ICAD. DFFA Protein, Human (GST) is a substrate for caspase-3 that triggers DNA breakage during apoptosis. DFFA Protein, Human (GST) is the recombinant human-derived DFFA protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
DFFA Protein is a heterodimeric complex of nuclease CAD and its specific inhibitor ICAD. DFFA Protein, Human (GST) is a substrate for caspase-3 that triggers DNA breakage during apoptosis. DFFA Protein, Human (GST) is the recombinant human-derived DFFA protein, expressed by E. coli , with N-GST labeled tag.
DNA fragmentation factor subunit alpha DNA (DFFA), also known as Caspase-activated DNase inhibitor (ICAD), is a human protein encoded by the DFFA gene. DFFA and DFFB are subunits of DNA break factor (DFF), substrates of caspase-3 that trigger DNA break during apoptosis. The C-terminal domain of DFFA (DFF-C) consists of four alpha-helices folded into a helical arrangement, with alpha-2 and alpha-3 arranged on a long C-terminal helix (alpha-4). The main function of this domain is to bind to the C-terminal catalytic domain of DFFB through ionic interactions, thereby inhibiting DNA breakage during apoptosis. DFFA plays an important role in cancer development[1][2][3][4].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
O00273 (M1-T331, R291W)
-
Molecular Construction
-
N-term
-
GST
-
DFFA (M1-T331, R291W)
Accession # O00273 -
C-term
-
-
Protein Length
Full Length
-
Mutation
R291W
-
Mutation Definition
Natural variant
-
Synonyms
DFFA; DNA Fragmentation Factor, 45kDa, Alpha Polypeptide; DNA Fragmentation Factor Subunit Alpha; DNA Fragmentation Factor 45 KDa Subunit; DFF-45; Inhibitor Of CAD; DFF45; DNA Fragmentation Factor, 45 KD, Alpha Polypeptide; ICAD; DNA Fragmentation Factor,
-
AA Sequence
MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
-
Predicted Molecular Mass
63.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
