DKK-1 Protein, Human (HEK293, N-His)
Based on 1 publication(s) in Google Scholar
DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293, N-His) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with N-8*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293, N-His) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with N-8*His labeled tag.
Background
DKK1 protein functions as a potent antagonist of canonical Wnt signaling through multiple mechanisms. It inhibits the interaction between LRP5/6 and Wnt and forms a ternary complex with the transmembrane protein KREMEN, facilitating the internalization of LRP5/6. Notably, DKK1 not only antagonizes the pro-apoptotic function of KREMEN1 in a Wnt-independent manner but also exhibits anti-apoptotic activity. The protein is implicated in limb development, where it modulates Wnt signaling to ensure normal limb patterning. Through its C-terminal Cys-rich domain, DKK1 interacts with LRP5 and LRP6, specifically engaging with beta-propeller regions 3 and 4 of LRP5. This interaction is further influenced by MESD and/or KREMEN, collectively leading to the attenuation of Wnt-mediated signaling. Additionally, DKK1 forms a ternary complex with LRP6 and KREM1, highlighting its multifaceted role in regulating crucial cellular processes and interactions with key proteins involved in Wnt signaling.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-8*His
-
Accession
O94907 (T32-H266)
-
Molecular Construction
-
N-term
-
8*His
-
DKK-1 (T32-H266)
Accession # O94907 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DKK1; Dickkopf 1 Homolog (Xenopus Laevis); Dickkopf Wnt Signaling Pathway Inhibitor 1; Dickkopf 1 Homolog; SK; Dickkopf-1 Like; DKK-1; Dickkopf-1; Dickkopf-Related Protein 1; HDkk-1; Dickkopf-Like Protein 1; Dkk-1; Dickkopf (Xenopus Laevis) Homolog 1
-
AA Sequence
TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
-
Predicted Molecular Mass
27 kDa
-
Molecular Weight
Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<0.01 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
