DKK-1 Protein, Rat (HEK293, His, solution)

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, His, solution) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-His labeled tag.

DKK-1 Protein is predicted to play a crucial role in co-receptor binding, low-density lipoprotein particle receptor binding, and receptor antagonist activity. It is involved in the negative regulation of ossification and the positive regulation of neuron death, and its primary localization is in the extracellular space. This protein is implicated in anodontia, and its biased expression pattern is evident, with notable levels observed in the kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. DKK-1's involvement in the WNT signaling pathway and its impact on visual epilepsy make it a significant factor in both developmental and neurological contexts.

Measured by its ability to inhibit Wnt3a induced alkaline phosphatase production by C3H10 T1/2 cells and the ED₅₀ for this effect is typically 0.05-0.3 μg/mL.

Rat

HEK293

C-His

A6I0Z0/NP_001099820.1 (T32-H270)

293897  [NCBI]

Full Length of Mature Protein

MTVVRAVAAVRFLVVLSTMALCSLPPLGVSATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLACRIQKDHHQTSNSSRLHTCQRH

Approximately 27.4 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.