DRD2 Protein, Human (sf9, Flag, His)

DRD2 Protein, Human (sf9, Flag, His) is the recombinant human-derived DRD2, expressed by sf9 insect cells , with His, Flag labeled tag. ,

DRD2 is a dopamine receptor whose activity is mediated by G proteins that inhibit adenylyl cyclase. Additionally, downstream of OPN5, DRD2 positively regulates postnatal regression of retinal hyaloid vessels by suppressing VEGFR2/KDR activity.

Human

Sf9 insect cells

His;Flag

P14416-1 (N35-V223, R361-C443, I122A, L375A, L379A)

1813

Partial

RKLSQQKEKKATQMAAIVAGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC

Approximately 52 kDa, based on SDS-PAGE under reducing conditions.

≥ 80%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM HEPES, pH 7.5, 150 mM NaCl, 0.01% , w/v LMNG, 0.001% , w/v CHS, 1 μM risperidone.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.