DRD2 Protein, Human (sf9, Flag, His)
Based on 1 Customer Validation
DRD2 Protein, Human (sf9, Flag, His) is the recombinant human-derived DRD2, expressed by sf9 insect cells , with His, Flag labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DRD2 Protein, Human (sf9, Flag, His) is the recombinant human-derived DRD2, expressed by sf9 insect cells , with His, Flag labeled tag. ,
Background
DRD2 is a dopamine receptor whose activity is mediated by G proteins that inhibit adenylyl cyclase. Additionally, downstream of OPN5, DRD2 positively regulates postnatal regression of retinal hyaloid vessels by suppressing VEGFR2/KDR activity.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag His;Flag
-
Accession
P14416-1 (N35-V223, R361-C443, I122A, L375A, L379A)
-
Gene ID1813
-
Protein Length
Partial
-
Synonyms
DRD2; D2R; Dopamine Receptor D2; Seven Transmembrane Helix Receptor; Dopamine D2 Receptor; D2DR; D(2) Dopamine Receptor
-
AA Sequence
RKLSQQKEKKATQMAAIVAGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
-
Molecular Weight
Approximately 52 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 20 mM HEPES, pH 7.5, 150 mM NaCl, 0.01% , w/v LMNG, 0.001% , w/v CHS, 1 μM risperidone.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (233 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
