E/Envelope Protein, Dengue virus 4 (101a.a, HEK293, His)
The NS1 protein plays a key role in viral budding, association with cell membranes, and facilitating the assembly of viral RNA into nucleocapsids to form mature viral particles.During entry, NS1 induces genome penetration into the host cytoplasm.E/Envelope Protein, Dengue virus 4 (101a.a, HEK293, His) is the recombinant Virus-derived E/Envelope protein, expressed by HEK293 , with C-His labeled tag.
- Species: Virus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The NS1 protein plays a key role in viral budding, association with cell membranes, and facilitating the assembly of viral RNA into nucleocapsids to form mature viral particles.During entry, NS1 induces genome penetration into the host cytoplasm.E/Envelope Protein, Dengue virus 4 (101a.a, HEK293, His) is the recombinant Virus-derived E/Envelope protein, expressed by HEK293 , with C-His labeled tag.
Background
The NS1 protein assumes a pivotal role in virus budding by binding to the cell membrane, facilitating the assembly of the viral RNA into a nucleocapsid that forms the core of a mature virus particle. During virus entry, NS1 may induce genome penetration into the host cytoplasm following hemifusion induced by surface proteins. Notably, NS1 exhibits the ability to migrate to the cell nucleus, where it modulates host functions. Additionally, NS1 counteracts the antiviral effects of host EXOC1 by sequestering and degrading EXOC1 through the proteasome degradation pathway. Furthermore, NS1 disrupts RNA silencing by interfering with host Dicer, highlighting its multifaceted role in manipulating both viral and host cellular processes throughout the infection cycle.
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag C-His
-
Accession
AAX48017 (T579-K679)
-
Gene ID/
-
Molecular Construction
-
N-term
-
DENV4 E (T579-K679)
Accession # AAX48017 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
E Protein; DENV; Dengue virus (DENV) (type 4, strain Philippines/H241/1956) E / Envelope Protein (aa 579-679, His Tag)
-
AA Sequence
TMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKVVGRIISSTPFAEYTNSVTNIELEPPFGDSYIVIGVGDSALTLHWFRKGSSIGK
-
Predicted Molecular Mass
12.4 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
