E-selectin/CD62E Protein, Cynomolgus (HEK293, hFc)

The E-selectin/CD62E protein belongs to the selectin/LECAM family and plays a crucial role in mediating cell adhesion processes, particularly the interaction between leukocytes and endothelial cells.As a member of this family, E-selectin may have conserved characteristics, underscoring its importance in cell adhesion.E-selectin/CD62E Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived E-selectin/CD62E protein, expressed by HEK293 , with C-hFc labeled tag.

The E-selectin/CD62E Protein is a vital member of the selectin/LECAM family, signifying its significant role in cell adhesion processes. As part of this family, E-selectin likely shares conserved structural and functional features with related proteins, indicating its involvement in mediating interactions between leukocytes and endothelial cells. The classification within the selectin/LECAM family underscores its specific designation within the broader context of cell adhesion molecules, providing insights into its unique contributions to cellular adhesion. The study of E-selectin/CD62E contributes to our understanding of its role in inflammatory responses and immune cell trafficking, offering potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular processes involved in immune surveillance and inflammation. Further exploration of E-selectin/CD62E's role holds promise for enhancing our knowledge of its contributions to normal physiology and pathological conditions.

Cynomolgus

HEK293

C-hFc

G8F370 (W22-P556)

/

Partial

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKRDKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLECEQIVNCTALESPEHGSLVCSHPLGNFSYSSSCSVSCDRGYLPSSVETTQCMSSGEWSVPIPACKVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAIRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGAAQVECTTQGQWTQQVPVCEAFQCTALSNPERGYMNCLPSASGSFRNGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPQRGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVLEKINMSCSGEPVFGTVCNFACPEGWRLNGSAAMTCGATGHWSGMLPTCEAPTESNTP

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.