E-selectin/CD62E Protein, Cynomolgus (HEK293, hFc)
The E-selectin/CD62E protein belongs to the selectin/LECAM family and plays a crucial role in mediating cell adhesion processes, particularly the interaction between leukocytes and endothelial cells.As a member of this family, E-selectin may have conserved characteristics, underscoring its importance in cell adhesion.E-selectin/CD62E Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived E-selectin/CD62E protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The E-selectin/CD62E protein belongs to the selectin/LECAM family and plays a crucial role in mediating cell adhesion processes, particularly the interaction between leukocytes and endothelial cells.As a member of this family, E-selectin may have conserved characteristics, underscoring its importance in cell adhesion.E-selectin/CD62E Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived E-selectin/CD62E protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The E-selectin/CD62E Protein is a vital member of the selectin/LECAM family, signifying its significant role in cell adhesion processes. As part of this family, E-selectin likely shares conserved structural and functional features with related proteins, indicating its involvement in mediating interactions between leukocytes and endothelial cells. The classification within the selectin/LECAM family underscores its specific designation within the broader context of cell adhesion molecules, providing insights into its unique contributions to cellular adhesion. The study of E-selectin/CD62E contributes to our understanding of its role in inflammatory responses and immune cell trafficking, offering potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular processes involved in immune surveillance and inflammation. Further exploration of E-selectin/CD62E's role holds promise for enhancing our knowledge of its contributions to normal physiology and pathological conditions.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-hFc
-
Accession
G8F370 (W22-P556)
-
Gene ID/
-
Molecular Construction
-
N-term
-
CD62E (W22-P556)
Accession # G8F370 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
SELE; ESEL; Prev. ELAM1; Endothelial Adhesion Molecule 1; Prev. ELAM; ELAM-1; Endothelial Leukocyte Adhesion Molecule 1; LECAM2; CD62 Antigen-Like Family Member E; Leukocyte Endothelial Cell Adhesion Molecule 2; E-Selectin; CD62E Antigen; CD62E; Selectin-
-
AA Sequence
WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKRDKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLECEQIVNCTALESPEHGSLVCSHPLGNFSYSSSCSVSCDRGYLPSSVETTQCMSSGEWSVPIPACKVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAIRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGAAQVECTTQGQWTQQVPVCEAFQCTALSNPERGYMNCLPSASGSFRNGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPQRGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVLEKINMSCSGEPVFGTVCNFACPEGWRLNGSAAMTCGATGHWSGMLPTCEAPTESNTP
-
Predicted Molecular Mass
85.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)