E-selectin/CD62E Protein, Cynomolgus (HEK293, hFc)

The E-selectin/CD62E protein belongs to the selectin/LECAM family and plays a crucial role in mediating cell adhesion processes, particularly the interaction between leukocytes and endothelial cells.As a member of this family, E-selectin may have conserved characteristics, underscoring its importance in cell adhesion.E-selectin/CD62E Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived E-selectin/CD62E protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The E-selectin/CD62E protein belongs to the selectin/LECAM family and plays a crucial role in mediating cell adhesion processes, particularly the interaction between leukocytes and endothelial cells.As a member of this family, E-selectin may have conserved characteristics, underscoring its importance in cell adhesion.E-selectin/CD62E Protein, Cynomolgus (HEK293, hFc) is the recombinant cynomolgus-derived E-selectin/CD62E protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The E-selectin/CD62E Protein is a vital member of the selectin/LECAM family, signifying its significant role in cell adhesion processes. As part of this family, E-selectin likely shares conserved structural and functional features with related proteins, indicating its involvement in mediating interactions between leukocytes and endothelial cells. The classification within the selectin/LECAM family underscores its specific designation within the broader context of cell adhesion molecules, providing insights into its unique contributions to cellular adhesion. The study of E-selectin/CD62E contributes to our understanding of its role in inflammatory responses and immune cell trafficking, offering potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular processes involved in immune surveillance and inflammation. Further exploration of E-selectin/CD62E's role holds promise for enhancing our knowledge of its contributions to normal physiology and pathological conditions.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD62E (W22-P556)
      Accession # G8F370
    • hFc
    • C-term
  • Protein Length

    Partial

  • Synonyms

    SELE; ESEL; Prev. ELAM1; Endothelial Adhesion Molecule 1; Prev. ELAM; ELAM-1; Endothelial Leukocyte Adhesion Molecule 1; LECAM2; CD62 Antigen-Like Family Member E; Leukocyte Endothelial Cell Adhesion Molecule 2; E-Selectin; CD62E Antigen; CD62E; Selectin-

  • AA Sequence

    WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKRDKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLECEQIVNCTALESPEHGSLVCSHPLGNFSYSSSCSVSCDRGYLPSSVETTQCMSSGEWSVPIPACKVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAIRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGAAQVECTTQGQWTQQVPVCEAFQCTALSNPERGYMNCLPSASGSFRNGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPQRGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVLEKINMSCSGEPVFGTVCNFACPEGWRLNGSAAMTCGATGHWSGMLPTCEAPTESNTP

  • Predicted Molecular Mass

    85.7 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00