EDA2R/XEDAR Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
The EDA2R/XEDAR proteins lack conserved residues critical for feature annotation propagation and exhibit unique characteristics that raise questions about their structural and functional aspects. This uniqueness suggests potential changes in molecular interactions and signaling pathways. EDA2R/XEDAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The EDA2R/XEDAR proteins lack conserved residues critical for feature annotation propagation and exhibit unique characteristics that raise questions about their structural and functional aspects. This uniqueness suggests potential changes in molecular interactions and signaling pathways. EDA2R/XEDAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EDA2R/XEDAR protein, expressed by HEK293 , with C-His labeled tag.
Background
EDA2R, also known as XEDAR, presents a distinctive feature as it lacks conserved residue(s) necessary for the propagation of feature annotation. This unique characteristic raises intriguing questions about the structural and functional aspects of EDA2R, hinting at potential variations in its molecular interactions and signaling pathways. The absence of these conserved residues highlights the need for in-depth investigations to elucidate the specific roles and regulatory mechanisms associated with EDA2R, shedding light on its contributions to cellular processes and biological functions.
Verified Bioactivity
Immobilized Recombinant Human EDA-A2 at 1 μg/mL (100 μL/well) can bind Recombinant Cynomolgus EDA2R. The ED50 for this effect is 153.9 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-6*His
-
Accession
XP_005593864.1 (M1-E137)
-
Molecular Construction
-
N-term
-
EDA2R (M1-E137)
Accession # XP_005593864.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
EDA2R; Tumor Necrosis Factor Receptor Superfamily Member 27; Ectodysplasin A2 Receptor; X-Linked Ectodysplasin-A2 Receptor; TNFRSF27; X-Linked EDA Receptor; XEDAR; EDA-A2 Receptor; EDA-A2R; Tumor Necrosis Factor Receptor Superfamily Member XEDAR; EDAA2R
-
AA Sequence
MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQEQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQE
-
Molecular Weight
Approximately 25-29 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)