Copy Link Print Information

EDAR Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

EDAR Protein, a receptor for EDA isoform A1, activates NF-kappa-B and JNK signaling pathways upon binding, eliciting diverse cellular responses. It may also contribute to caspase-independent cell death. EDAR forms a complex with EDARADD and associates with signaling molecules like TRAF1, TRAF2, TRAF3, and NIK, highlighting its participation in intricate signaling cascades. EDAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EDAR protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for EDAR Protein, Cynomolgus (HEK293, His)
  • Experimental Validation Results for EDAR Protein, Cynomolgus (HEK293, His)
  • EDAR Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

EDAR Protein, a receptor for EDA isoform A1, activates NF-kappa-B and JNK signaling pathways upon binding, eliciting diverse cellular responses. It may also contribute to caspase-independent cell death. EDAR forms a complex with EDARADD and associates with signaling molecules like TRAF1, TRAF2, TRAF3, and NIK, highlighting its participation in intricate signaling cascades. EDAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EDAR protein, expressed by HEK293 , with C-His labeled tag.

Background

EDAR serves as a receptor specifically for EDA isoform A1, distinguishing it from EDA isoform A2. Upon binding, EDAR facilitates the activation of NF-kappa-B and JNK signaling pathways, potentially leading to various cellular responses. Additionally, EDAR may play a role in promoting caspase-independent cell death. The receptor forms a complex with EDARADD, and it is associated with key signaling molecules such as TRAF1, TRAF2, TRAF3, and NIK, indicating its involvement in intricate signaling cascades.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus EDAR at 2 μg/mL (100 μL/well) can bind Anti-EDAR antibody, The ED50 for this effect is 473.9 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus EDAR at 2 μg/mL (100 μL/well) can bind Anti-EDAR antibody, The ED50 for this effect is 473.9 ng/mL.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-6*His
  • Accession

    A0A2K5VY41 (E27-A187)

  • Gene ID
    102120238  [NCBI]
  • Molecular Construction
    • N-term
    • EDAR (E27-A187)
      Accession # A0A2K5VY41
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    EDAR; Ectodermal Dysplasia Receptor; Prev. DL; Downless Homolog; Prev. ED3; EDA-A1 Receptor; Tumor Necrosis Factor Receptor Superfamily Member EDAR; Hypohidrotic Ectodermal Dysplasia; EDA1R; Downless, Mouse, Homolog Of; EDA3; Ectodysplasin-A Receptor; ED1

  • AA Sequence

    EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPLQHAHKELSGQGHLATA

  • Molecular Weight

    Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, PH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus EDAR at 2 μg/mL (100 μL/well) can bind Anti-EDAR antibody, The ED50 for this effect is 473.9 ng/mL.

  • EDAR Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for EDAR Protein, Cynomolgus (HEK293, His)
  • Experimental Validation Results for EDAR Protein, Cynomolgus (HEK293, His)
  • EDAR Protein, Cynomolgus (HEK293, His) Product Image