1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TNF Superfamily Cytokine Receptors
  4. TNF Receptor Superfamily
  5. EDAR
  6. EDAR Protein, Cynomolgus (HEK293, His)

EDAR Protein, a receptor for EDA isoform A1, activates NF-kappa-B and JNK signaling pathways upon binding, eliciting diverse cellular responses. It may also contribute to caspase-independent cell death. EDAR forms a complex with EDARADD and associates with signaling molecules like TRAF1, TRAF2, TRAF3, and NIK, highlighting its participation in intricate signaling cascades. EDAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EDAR protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EDAR Protein, a receptor for EDA isoform A1, activates NF-kappa-B and JNK signaling pathways upon binding, eliciting diverse cellular responses. It may also contribute to caspase-independent cell death. EDAR forms a complex with EDARADD and associates with signaling molecules like TRAF1, TRAF2, TRAF3, and NIK, highlighting its participation in intricate signaling cascades. EDAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EDAR protein, expressed by HEK293 , with C-His labeled tag.

Background

EDAR serves as a receptor specifically for EDA isoform A1, distinguishing it from EDA isoform A2. Upon binding, EDAR facilitates the activation of NF-kappa-B and JNK signaling pathways, potentially leading to various cellular responses. Additionally, EDAR may play a role in promoting caspase-independent cell death. The receptor forms a complex with EDARADD, and it is associated with key signaling molecules such as TRAF1, TRAF2, TRAF3, and NIK, indicating its involvement in intricate signaling cascades.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus EDAR at 2 μg/mL (100 μL/well) can bind Anti-EDAR antibody, The ED50 for this effect is 473.9 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus EDAR at 2 μg/mL (100 μL/well) can bind Anti-EDAR antibody, The ED50 for this effect is 473.9 ng/mL.
Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

A0A2K5VY41 (E27-A187)

Gene ID
Molecular Construction
N-term
EDAR (E27-A187)
Accession # A0A2K5VY41
His
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor receptor superfamily member EDAR; EDA-A1 receptor; EDAR
AA Sequence

EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPLQHAHKELSGQGHLATA

Molecular Weight

Approximately 17-23 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, PH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

EDAR Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EDAR Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P76896
Quantity:
MCE Japan Authorized Agent: