EDAR Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
EDAR Protein, a receptor for EDA isoform A1, activates NF-kappa-B and JNK signaling pathways upon binding, eliciting diverse cellular responses. It may also contribute to caspase-independent cell death. EDAR forms a complex with EDARADD and associates with signaling molecules like TRAF1, TRAF2, TRAF3, and NIK, highlighting its participation in intricate signaling cascades. EDAR Protein, Human (HEK293, Fc) is the recombinant human-derived EDAR protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
EDAR Protein, a receptor for EDA isoform A1, activates NF-kappa-B and JNK signaling pathways upon binding, eliciting diverse cellular responses. It may also contribute to caspase-independent cell death. EDAR forms a complex with EDARADD and associates with signaling molecules like TRAF1, TRAF2, TRAF3, and NIK, highlighting its participation in intricate signaling cascades. EDAR Protein, Human (HEK293, Fc) is the recombinant human-derived EDAR protein, expressed by HEK293 , with C-hFc labeled tag.
Background
EDAR serves as a receptor specifically for EDA isoform A1, distinguishing it from EDA isoform A2. Upon binding, EDAR facilitates the activation of NF-kappa-B and JNK signaling pathways, potentially leading to various cellular responses. Additionally, EDAR may play a role in promoting caspase-independent cell death. The receptor forms a complex with EDARADD, and it is associated with key signaling molecules such as TRAF1, TRAF2, TRAF3, and NIK, indicating its involvement in intricate signaling cascades.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9UNE0-1 (E27-I189)
-
Molecular Construction
-
N-term
-
EDAR (E27-I189)
Accession # Q9UNE0-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
EDAR; Ectodermal Dysplasia Receptor; Prev. DL; Downless Homolog; Prev. ED3; EDA-A1 Receptor; Tumor Necrosis Factor Receptor Superfamily Member EDAR; Hypohidrotic Ectodermal Dysplasia; EDA1R; Downless, Mouse, Homolog Of; EDA3; Ectodysplasin-A Receptor; ED1
-
AA Sequence
EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSGQGHLATALI
-
Predicted Molecular Mass
44.6 kDa
-
Molecular Weight
Approximately 52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
