EDF1/MBF1 Protein, Human (His)
The EDF1/MBF1 protein is a transcriptional coactivator that stimulates NR5A1, NR1H3/LXRA, and PPARG transcriptional activity. It enhances ATF1, ATF2, CREB1 and NR5A1 DNA binding. EDF1/MBF1 Protein, Human (His) is the recombinant human-derived EDF1/MBF1 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The EDF1/MBF1 protein is a transcriptional coactivator that stimulates NR5A1, NR1H3/LXRA, and PPARG transcriptional activity. It enhances ATF1, ATF2, CREB1 and NR5A1 DNA binding. EDF1/MBF1 Protein, Human (His) is the recombinant human-derived EDF1/MBF1 protein, expressed by E. coli , with C-6*His labeled tag.
EDF1/MBF1, a transcriptional coactivator, stimulates the transcriptional activities of NR5A1 and ligand-dependent NR1H3/LXRA and PPARG. It plays a pivotal role in enhancing the DNA-binding activity of ATF1, ATF2, CREB1, and NR5A1. Additionally, EDF1/MBF1 is implicated in the regulation of nitric oxide synthase activity, potentially by sequestering calmodulin in the cytoplasm. Its diverse functions extend to endothelial cell differentiation, hormone-induced cardiomyocyte hypertrophy, and lipid metabolism. EDF1/MBF1 interacts with key players in transcriptional regulation, such as TBP and the TFIID complex, NR5A2, NR1H3, and PPARG. The interaction with TBP is subject to regulation through phosphorylation. Furthermore, EDF1/MBF1 binds to NR5A1, ATF1, FOS, and JUN through their conserved basic regions, and its binding to calmodulin is modulated by calcium levels and IQ motif phosphorylation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
O60869 (A2-K148)
-
Molecular Construction
-
N-term
-
EDF1 (A2-K148)
Accession # O60869 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
EDF1; MBF1; Endothelial Differentiation Related Factor 1; Multiprotein Bridging Factor-1; EDF-1; Multiprotein Bridging Factor 1; Endothelial Differentiation-Related Factor 1; Multiprotein-Bridging Factor 1; CFAP280
-
AA Sequence
AESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
-
Predicted Molecular Mass
17.4 kDa
-
Molecular Weight
Approximately 16-20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
