1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. EGF
  5. EGF Protein, Human (HEK293, His)

EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. EGF Protein, Human (HEK293, His) is the recombinant human-derived EGF protein, expressed by HEK293, with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. EGF Protein, Human (HEK293, His) is the recombinant human-derived EGF protein, expressed by HEK293, with N-His labeled tag.

Background

GMP EGF Protein emerges as a potent stimulator of the growth of diverse epidermal and epithelial tissues in both in vivo and in vitro environments, along with fostering the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesiotropic hormone, driving magnesium reabsorption in the renal distal convoluted tubule through the engagement of EGFR and activation of the magnesium channel TRPM6. Notably, GMP EGF Protein possesses the capability to induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro. Its molecular interactions include binding to EGFR, thereby promoting EGFR dimerization, and interacting with RHBDF2, suggesting involvement in diverse cellular processes. Furthermore, GMP EGF Protein engages with RHBDF1, potentially influencing the retention of EGF in the endoplasmic reticulum and regulating its degradation through endoplasmic reticulum-associated degradation (ERAD).

Biological Activity

1.Measured by its binding ability in a functional ELISA. Immobilized Human EGF Protein, His Tag at 2 μg/mL (100 μL/well) can bind Human EGF R, Fc Tag.Human EGF Protein, His Tag with the EC50 of 1.42 ng/mL.
2.Human EGF Protein, His Tag stimulates EGFR (Luc) HEK293 Reporter Cell. The specific activity of Human EGF Protein, His Tag is > 3.00 X 105 IU/mg, which is calibrated against human growth factor EGF WHO International Standard.

Species

Human

Source

HEK293

Tag

N-His

Accession

P01133-1 (N971-R1023)

Gene ID

1950

Molecular Construction
N-term
His
EGF (N971-R1023)
Accession # P01133
C-term
Protein Length

Partial

Synonyms
rHuEGF; Pro-epidermal growth factor; Urogastrone
AA Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Predicted Molecular Mass
8.3 kDa.
Molecular Weight

10-11 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with 10% trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EGF Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

EGF Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGF Protein, Human (HEK293, His)
Cat. No.:
HY-P704573
Quantity:
MCE Japan Authorized Agent: