EGF Protein, Human (HEK293, mFc)
EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. EGF Protein, Human (HEK293, mFc) is the recombinant human-derived EGF protein, expressed by HEK293, with N-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
EGF proteins act as potent stimulators of growth in a variety of epidermal and epithelial tissues in both in vivo and in vitro settings, while promoting the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesium stimulating hormone, driving magnesium reabsorption in the renal distal tubule through engagement of EGFR and activation of the magnesium channel TRPM6. EGF Protein, Human (HEK293, mFc) is the recombinant human-derived EGF protein, expressed by HEK293, with N-mFc labeled tag.
Background
GMP EGF Protein emerges as a potent stimulator of the growth of diverse epidermal and epithelial tissues in both in vivo and in vitro environments, along with fostering the proliferation of specific fibroblasts in cell culture. This multifaceted protein also acts as a magnesiotropic hormone, driving magnesium reabsorption in the renal distal convoluted tubule through the engagement of EGFR and activation of the magnesium channel TRPM6. Notably, GMP EGF Protein possesses the capability to induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro. Its molecular interactions include binding to EGFR, thereby promoting EGFR dimerization, and interacting with RHBDF2, suggesting involvement in diverse cellular processes. Furthermore, GMP EGF Protein engages with RHBDF1, potentially influencing the retention of EGF in the endoplasmic reticulum and regulating its degradation through endoplasmic reticulum-associated degradation (ERAD).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-mFc
-
Accession
P01133-1 (N971-R1023)
-
Gene ID1950
-
Molecular Construction
-
N-term
-
mFc
-
EGF (N971-R1023)
Accession # P01133 -
C-term
-
-
Protein Length
Full Length of EGF
-
Synonyms
EGF; Alternative Protein EGF; Epidermal Growth Factor; Beta-Urogastrone; Pro-Epidermal Growth Factor; HOMG4; Epidermal Growth Factor (Beta-Urogastrone); URG
-
AA Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
-
Predicted Molecular Mass
33.1 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
