1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. EGFL7/VE-Statin Protein, Human (sf9, His)

EGFL7/VE-statin is an important coordinator of vascular dynamics, affecting angiogenesis in vivo and inhibiting PDGF-BB-induced smooth muscle cell migration, thereby affecting vascular remodeling. It plays a key role in promoting endothelial cell adhesion and contributes to angiogenesis, emphasizing its regulatory influence on vascular development. EGFL7/VE-Statin Protein, Human (sf9, His) is the recombinant human-derived EGFL7/VE-Statin protein, expressed by Sf9 insect cells , with N-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock
10 μg Pide un presupuesto y un plazo de entrega
50 μg Pide un presupuesto y un plazo de entrega
100 μg Pide un presupuesto y un plazo de entrega

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

EGFL7/VE-statin is an important coordinator of vascular dynamics, affecting angiogenesis in vivo and inhibiting PDGF-BB-induced smooth muscle cell migration, thereby affecting vascular remodeling. It plays a key role in promoting endothelial cell adhesion and contributes to angiogenesis, emphasizing its regulatory influence on vascular development. EGFL7/VE-Statin Protein, Human (sf9, His) is the recombinant human-derived EGFL7/VE-Statin protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

EGFL7, also known as VE-Statin, emerges as a crucial orchestrator of vascular dynamics with significant roles in vivo vascular tubulogenesis. This multifunctional protein exhibits inhibitory effects on platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration, thereby influencing vascular remodeling. Additionally, EGFL7 plays a pivotal role in promoting endothelial cell adhesion to the extracellular matrix and contributes to angiogenesis, emphasizing its regulatory influence on vascular development. Through its interaction with ITGAV/ITGB3 in an RGD-dependent manner, EGFL7 enhances endothelial cell motility, further underscoring its involvement in the intricate processes that govern vascular function and homeostasis.

Species

Human

Source

Sf9 insect cells

Tag

N-10*His

Accession

Q9UHF1 (Y24-S273)

Gene ID
Molecular Construction
N-term
10*His
EGFL7 (Y24-S273)
Accession # Q9UHF1
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Epidermal growth factor-like protein 7; NOTCH4-like protein; VE-statin; MEGF7
AA Sequence

YRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS

Predicted Molecular Mass
29.4 kDa
Peso molecular

Approximately 31 kDa,based on SDS-PAGE under reducing conditions.

Pureza

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación

EGFL7/VE-Statin Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

EGFL7/VE-Statin Protein, Human (sf9, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
EGFL7/VE-Statin Protein, Human (sf9, His)
Cat. No.:
HY-P75730
Cantidad:
MCE Japan Authorized Agent: