EGFL7/VE-Statin Protein, Human (sf9, His)

EGFL7/VE-statin is an important coordinator of vascular dynamics, affecting angiogenesis in vivo and inhibiting PDGF-BB-induced smooth muscle cell migration, thereby affecting vascular remodeling. It plays a key role in promoting endothelial cell adhesion and contributes to angiogenesis, emphasizing its regulatory influence on vascular development. EGFL7/VE-Statin Protein, Human (sf9, His) is the recombinant human-derived EGFL7/VE-Statin protein, expressed by Sf9 insect cells , with N-His labeled tag.

EGFL7, also known as VE-Statin, emerges as a crucial orchestrator of vascular dynamics with significant roles in vivo vascular tubulogenesis. This multifunctional protein exhibits inhibitory effects on platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration, thereby influencing vascular remodeling. Additionally, EGFL7 plays a pivotal role in promoting endothelial cell adhesion to the extracellular matrix and contributes to angiogenesis, emphasizing its regulatory influence on vascular development. Through its interaction with ITGAV/ITGB3 in an RGD-dependent manner, EGFL7 enhances endothelial cell motility, further underscoring its involvement in the intricate processes that govern vascular function and homeostasis.

Human

Sf9 insect cells

N-10*His

Q9UHF1 (Y24-S273)

51162  [NCBI]

Full Length of Mature Protein

YRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS

Approximately 31 kDa,based on SDS-PAGE under reducing conditions.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.