EGFL7/VE-Statin Protein, Human (sf9, His)
EGFL7/VE-statin is an important coordinator of vascular dynamics, affecting angiogenesis in vivo and inhibiting PDGF-BB-induced smooth muscle cell migration, thereby affecting vascular remodeling. It plays a key role in promoting endothelial cell adhesion and contributes to angiogenesis, emphasizing its regulatory influence on vascular development. EGFL7/VE-Statin Protein, Human (sf9, His) is the recombinant human-derived EGFL7/VE-Statin protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
EGFL7/VE-statin is an important coordinator of vascular dynamics, affecting angiogenesis in vivo and inhibiting PDGF-BB-induced smooth muscle cell migration, thereby affecting vascular remodeling. It plays a key role in promoting endothelial cell adhesion and contributes to angiogenesis, emphasizing its regulatory influence on vascular development. EGFL7/VE-Statin Protein, Human (sf9, His) is the recombinant human-derived EGFL7/VE-Statin protein, expressed by Sf9 insect cells , with N-His labeled tag.
Background
EGFL7, also known as VE-Statin, emerges as a crucial orchestrator of vascular dynamics with significant roles in vivo vascular tubulogenesis. This multifunctional protein exhibits inhibitory effects on platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration, thereby influencing vascular remodeling. Additionally, EGFL7 plays a pivotal role in promoting endothelial cell adhesion to the extracellular matrix and contributes to angiogenesis, emphasizing its regulatory influence on vascular development. Through its interaction with ITGAV/ITGB3 in an RGD-dependent manner, EGFL7 enhances endothelial cell motility, further underscoring its involvement in the intricate processes that govern vascular function and homeostasis.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-10*His
-
Accession
Q9UHF1 (Y24-S273)
-
Molecular Construction
-
N-term
-
10*His
-
EGFL7 (Y24-S273)
Accession # Q9UHF1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
EGFL7; EGF-Like Protein 7; EGF Like Domain Multiple 7; EGF-Like-Domain, Multiple 7; ZNEU1; VE-STATIN; Multiple Epidermal Growth Factor-Like Domains Protein 7; VE-Statin; Epidermal Growth Factor-Like Protein 7; Zneu1; Multiple EGF-Like Domains Protein 7; M
-
AA Sequence
YRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
-
Predicted Molecular Mass
29.4 kDa
-
Molecular Weight
Approximately 31 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
