1. Recombinant Proteins
  2. Others
  3. EIF3K Protein, Human (sf9, His-GST)

The eIF3K protein is an important component of the eukaryotic translation initiation factor 3 (eIF-3) complex and plays a crucial role in various steps of protein synthesis initiation.It stimulates recruitment of mRNA to the 43S preinitiation complex (43S PIC) and promotes AUG recognition scanning.EIF3K Protein, Human (sf9, His-GST) is the recombinant human-derived EIF3K protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
100 μg Auf Lager
> 100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

The eIF3K protein is an important component of the eukaryotic translation initiation factor 3 (eIF-3) complex and plays a crucial role in various steps of protein synthesis initiation.It stimulates recruitment of mRNA to the 43S preinitiation complex (43S PIC) and promotes AUG recognition scanning.EIF3K Protein, Human (sf9, His-GST) is the recombinant human-derived EIF3K protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

eIF3K protein is an integral component of the eukaryotic translation initiation factor 3 (eIF-3) complex, a crucial assembly required for various steps in protein synthesis initiation. This complex associates with the 40S ribosome, facilitating the recruitment of essential factors to form the 43S pre-initiation complex (43S PIC). eIF-3K within the eIF-3 complex stimulates mRNA recruitment to the 43S PIC and assists in scanning the mRNA for AUG recognition. Furthermore, the eIF-3 complex plays a pivotal role in disassembling and recycling post-termination ribosomal complexes, preventing premature joining of the 40S and 60S ribosomal subunits before initiation. Notably, eIF-3K contributes to the translation initiation of specific mRNAs involved in cell proliferation, including those related to cell cycling, differentiation, and apoptosis. Through different modes of RNA stem-loop binding, eIF-3K can exert either translational activation or repression. The eIF-3 complex, to which eIF-3K belongs, comprises 13 subunits and is organized into three stable modules (A, B, and C), with eIF-3K situated in module C. Interactions with other subunits, such as EIF3J and CCND3, highlight the intricate regulatory network in which eIF3K is involved, providing further insights into its multifaceted role in translation initiation and cellular processes.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

Q9UBQ5 (A2-Q218)

Gene ID
Molecular Construction
N-term
His-GST
eIF3K (A2-Q218)
Accession # Q9UBQ5
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Eukaryotic translation initiation factor 3 subunit K; PLAC-24; eIF-3 p25; EIF3S12
AA Sequence

AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ

Molekulargewicht

Approximately 47 kDa

Reinheit

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM Nacl, 3 mM DTT, pH 7.4, 10% Glycerol, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Dokumentation

EIF3K Protein, Human (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

EIF3K Protein, Human (sf9, His-GST)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
EIF3K Protein, Human (sf9, His-GST)
Art. -Nr.:
HY-P76901
Menge:
MCE Japan Authorized Agent: