EIF3K Protein, Human (sf9, His-GST)

Customer Review

Based on 1 Customer Validation

The eIF3K protein is an important component of the eukaryotic translation initiation factor 3 (eIF-3) complex and plays a crucial role in various steps of protein synthesis initiation.It stimulates recruitment of mRNA to the 43S preinitiation complex (43S PIC) and promotes AUG recognition scanning.EIF3K Protein, Human (sf9, His-GST) is the recombinant human-derived EIF3K protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The eIF3K protein is an important component of the eukaryotic translation initiation factor 3 (eIF-3) complex and plays a crucial role in various steps of protein synthesis initiation.It stimulates recruitment of mRNA to the 43S preinitiation complex (43S PIC) and promotes AUG recognition scanning.EIF3K Protein, Human (sf9, His-GST) is the recombinant human-derived EIF3K protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

eIF3K protein is an integral component of the eukaryotic translation initiation factor 3 (eIF-3) complex, a crucial assembly required for various steps in protein synthesis initiation. This complex associates with the 40S ribosome, facilitating the recruitment of essential factors to form the 43S pre-initiation complex (43S PIC). eIF-3K within the eIF-3 complex stimulates mRNA recruitment to the 43S PIC and assists in scanning the mRNA for AUG recognition. Furthermore, the eIF-3 complex plays a pivotal role in disassembling and recycling post-termination ribosomal complexes, preventing premature joining of the 40S and 60S ribosomal subunits before initiation. Notably, eIF-3K contributes to the translation initiation of specific mRNAs involved in cell proliferation, including those related to cell cycling, differentiation, and apoptosis. Through different modes of RNA stem-loop binding, eIF-3K can exert either translational activation or repression. The eIF-3 complex, to which eIF-3K belongs, comprises 13 subunits and is organized into three stable modules (A, B, and C), with eIF-3K situated in module C. Interactions with other subunits, such as EIF3J and CCND3, highlight the intricate regulatory network in which eIF3K is involved, providing further insights into its multifaceted role in translation initiation and cellular processes.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • eIF3K (A2-Q218)
      Accession # Q9UBQ5
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    EIF3K; Muscle-Specific Gene M9 Protein; Prev. EIF3S12; EIF-3 P25; PLAC-24; EIF3k; PRO1474; CDNA FLJ55131, Highly Similar To Eukaryotic Translation Initiation Factor 3 Subunit 12; HSPC029; Eukaryotic Translation Initiation Factor 3, Subunit K; PTD001; Musc

  • AA Sequence

    AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ

  • Predicted Molecular Mass

    52.8 kDa

  • Molecular Weight

    Approximately 47 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM Nacl, 3 mM DTT, pH 7.4, 10% Glycerol, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00