eltD Protein, Mycolicibacterium smegmatis 155 (His, StrepⅡ)

The eltD protein is a key enzyme responsible for coordinating the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate, thereby forming gluconolactone. Notably, it is versatile, utilizing NAD(+) and NADP(+) as electron acceptors. eltD Protein, Mycolicibacterium smegmatis 155 (His, Strep) is the recombinant eltD protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The eltD protein is a key enzyme responsible for coordinating the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate, thereby forming gluconolactone. Notably, it is versatile, utilizing NAD(+) and NADP(+) as electron acceptors. eltD Protein, Mycolicibacterium smegmatis 155 (His, Strep) is the recombinant eltD protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

Background

gdh2 protein plays a pivotal role in cellular metabolism by catalyzing the NAD(P)(+)-dependent oxidation of D-glucose to D-gluconate through the formation of gluconolactone. Remarkably versatile, it exhibits the ability to utilize both NAD(+) and NADP(+) as electron acceptors. Operating within the framework of the Entner-Doudoroff pathway, gdh2 is instrumental in the non-phosphorylative degradation of glucose. This multifaceted enzymatic activity underscores its importance in the cellular machinery responsible for glucose catabolism, contributing to the generation of metabolic intermediates essential for various cellular processes.

Technical Parameters

  • Species Others
  • Source E. coli
  • Tag N-StrepⅡ;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • StrepⅡ-6*His
    • eltD (S2-A362)
      Accession # A0QXD8
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Erythritol/L-threitol dehydrogenase; EC:1.1.1.-; eltD; MSMEG_3265; MSMEI_3181

  • AA Sequence

    SNQVPEKMQAVVCHGPHDYRLEEVAVPQRKPGEALIRVEAVGICASDLKCYHGAAKFWGDENRPAWAETMVIPGHEFVGRVVELDDEAAQRWGIAVGDRVVSEQIVPCWECLFCKRGQYHMCQPHDLYGFKRRTPGAMASYMVYPAEALVHKVSPDIPAQHAAFAEPLSCSLHAVERAQITFEDTVVVAGCGPIGLGMIAGAKAKSPMRVIALDMAPDKLKLAEKCGADLTINIAEQDAEKIIKDLTGGYGADVYIEGTGHTSAVPQGLNLLRKLGRYVEYGVFGSDVTVDWSIISDDKELDVLGAHLGPYCWPAAIKMIESGALPMDEICTHQFPLTEFQKGLDLVASGKESVKVSLIPA

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00