EpCAM/TROP1 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The EpCAM/TROP1 protein serves as a multifunctional molecule that promotes homogeneous interactions between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) in the mucosal epithelium. This suggests a crucial role in establishing an immune barrier against mucosal infection. EpCAM/TROP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The EpCAM/TROP1 protein serves as a multifunctional molecule that promotes homogeneous interactions between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) in the mucosal epithelium. This suggests a crucial role in establishing an immune barrier against mucosal infection. EpCAM/TROP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The EpCAM/TROP1 protein serves a multifaceted role, potentially acting as a physical homophilic interaction molecule that facilitates direct contact between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium. This interaction suggests a pivotal function in establishing an immunological barrier, serving as the first line of defense against mucosal infections. Beyond its involvement in mucosal immunity, EpCAM/TROP1 plays a significant role in the proliferation and differentiation of embryonic stem cells. Moreover, it exhibits regulatory influence by up-regulating the expression of FABP5, MYC, and cyclins A and E, implicating EpCAM/TROP1 in the modulation of key cellular processes. Its monomeric nature and interaction with phosphorylated CLDN7 underscore the intricacies of its molecular interactions, shedding light on its diverse functions in cellular physiology.

Verified Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of the L929 mouse fibroblast cell line. The ED50 for this effect is 0.3645 μg/mL in the presence of 0.5 μg/mL Fibronectin, corresponding to a specific activity is 2.74×10^3 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE. The protein migrates as 30-38 kDa under reducing condition (SDS-PAGE) due to glycosylation.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by the ability of the immobilized protein to support the adhesion of the L929 mouse fibroblast cell line. The ED50 for this effect is 0.3645 μg/mL in the presence of 0.5 μg/mL Fibronectin, corresponding to a specific activity is 2.74×103 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • EpCAM/TROP1 (Q24-T266)
      Accession # Q99JW5/AAH05618.1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    EPCAM; HEA125; Prev. TACSTD1; CO-17A; Prev. MIC18; EGP314; Prev. M4S1; EGP34; Tumor-Associated Calcium Signal Transducer 1; CD326; TROP1; MOC31; KSA; 17-1A; GA733-2; Ly74; Ber-Ep4; MH99; Ep-CAM; Membrane Component, Chromosome 4, Surface Marker (35kD Glyco

  • AA Sequence

    QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

  • Molecular Weight

    Approximately 33-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00